3IXK - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Title :   POTENT BETA-SECRETASE 1 INHIBITOR

Authors :   N. Borkakoti, J. D. Lindberg, S. Nystrom

Date :   04 Sep 09 (Deposition) - 08 Sep 10 (Release) - 08 Sep 10 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.50

Chains :   Asym. Unit : A,B,C
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)
Biol. Unit 3: C  (1x)

Keywords :   Bace, Beta-Secretase, Statine, Inhibitor, Aspartyl Protease, Glycoprotein, Hydrolase, Membrane, Protease, Transmembrane, Zymogen, Disulfide Bond (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   F. Wangsell, K. Gustafsson, I. Kvarnstrom, N. Borkakoti, M. Edlund, K. Jansson, J. Lindberg, A. Hallberg, A. Rosenquist, B. Samuelsson
Synthesis Of Potent Bace-1 Inhibitors Incorporating A Hydroxyethylene Isostere As Central Core.
Eur. J. Med. Chem. V. 45 870 2010
PubMed-ID: 20036448 | Reference-DOI: 10.1016/J.EJMECH.2009.11.013

Molecule 1 - BETA-SECRETASE 1
	Chains	:	A, B, C
	EC Number	:	3.4.23.46
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET11A
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Fragment	:	UNP RESIDUES 42-446
	Gene	:	BACE1, BACE, KIAA1149
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	BETA-SITE AMYLOID PRECURSOR PROTEIN CLEAVING ENZYME 1, BETA- SITE APP CLEAVING ENZYME 1, MEMBRANE-ASSOCIATED ASPARTIC PROTEASE 2, MEMAPSIN-2, ASPARTYL PROTEASE 2, ASP 2, ASP2

		1	2	3
Asymmetric Unit	:	A	B	C
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B
Biological Unit 3 (1x)	:			C

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 3)

No.	Name	Count	Type	Full Name
1	929	3	Ligand/Ion	N-[(2S,3S,5R)-1-[(3,5-DIFLUOROPHENYL)METHOXY]-3-HYDROXY-5-METHYL-6-[[(2S)-3-METHYL-1-OXO-1-(PHENYLMETHYLAMINO)BUTAN-2-YL]AMINO]-6-OXO-HEXAN-2-YL]-5-(METHYL-METHYLSULFONYL-AMINO)-N'-[(1R)-1-PHENYLETHYL]BENZENE-1,3-DICARBOXAMIDE

Biological Unit 1 (1, 1)

No.	Name	Count	Type	Full Name
1	929	1	Ligand/Ion	N-[(2S,3S,5R)-1-[(3,5-DIFLUOROPHENYL)METHOXY]-3-HYDROXY-5-METHYL-6-[[(2S)-3-METHYL-1-OXO-1-(PHENYLMETHYLAMINO)BUTAN-2-YL]AMINO]-6-OXO-HEXAN-2-YL]-5-(METHYL-METHYLSULFONYL-AMINO)-N'-[(1R)-1-PHENYLETHYL]BENZENE-1,3-DICARBOXAMIDE

Biological Unit 2 (1, 1)

No.	Name	Count	Type	Full Name
1	929	1	Ligand/Ion	N-[(2S,3S,5R)-1-[(3,5-DIFLUOROPHENYL)METHOXY]-3-HYDROXY-5-METHYL-6-[[(2S)-3-METHYL-1-OXO-1-(PHENYLMETHYLAMINO)BUTAN-2-YL]AMINO]-6-OXO-HEXAN-2-YL]-5-(METHYL-METHYLSULFONYL-AMINO)-N'-[(1R)-1-PHENYLETHYL]BENZENE-1,3-DICARBOXAMIDE

Biological Unit 3 (1, 1)

No.	Name	Count	Type	Full Name
1	929	1	Ligand/Ion	N-[(2S,3S,5R)-1-[(3,5-DIFLUOROPHENYL)METHOXY]-3-HYDROXY-5-METHYL-6-[[(2S)-3-METHYL-1-OXO-1-(PHENYLMETHYLAMINO)BUTAN-2-YL]AMINO]-6-OXO-HEXAN-2-YL]-5-(METHYL-METHYLSULFONYL-AMINO)-N'-[(1R)-1-PHENYLETHYL]BENZENE-1,3-DICARBOXAMIDE

Asymmetric Unit (3, 3)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLY A:59 , GLN A:60 , GLY A:61 , ASP A:80 , GLY A:82 , SER A:83 , VAL A:117 , PRO A:118 , TYR A:119 , THR A:120 , GLN A:121 , GLY A:122 , LYS A:155 , PHE A:156 , ILE A:158 , ILE A:174 , TYR A:246 , ASP A:276 , SER A:277 , GLY A:278 , THR A:279 , THR A:280 , ASN A:281 , ARG A:283 , SER A:373 , HOH A:501	BINDING SITE FOR RESIDUE 929 A 500
2	AC2	SOFTWARE	GLY B:59 , GLN B:60 , GLY B:61 , ASP B:80 , GLY B:82 , VAL B:117 , PRO B:118 , TYR B:119 , THR B:120 , GLN B:121 , GLY B:122 , LYS B:155 , PHE B:156 , ILE B:158 , TRP B:163 , ILE B:174 , TYR B:246 , ASP B:276 , SER B:277 , GLY B:278 , THR B:279 , THR B:280 , ASN B:281 , ARG B:283 , SER B:373	BINDING SITE FOR RESIDUE 929 B 500
3	AC3	SOFTWARE	GLY C:59 , GLN C:60 , GLY C:61 , ASP C:80 , GLY C:82 , VAL C:117 , PRO C:118 , TYR C:119 , THR C:120 , GLN C:121 , GLY C:122 , LYS C:155 , PHE C:156 , ILE C:158 , TYR C:246 , ASP C:276 , SER C:277 , GLY C:278 , THR C:279 , THR C:280 , ASN C:281 , ARG C:283 , SER C:373	BINDING SITE FOR RESIDUE 929 C 500

Asymmetric Unit

No.	Residues
1	A:203	-	A:407
2	A:265	-	A:430
3	A:317	-	A:367
4	B:203	-	B:407
5	B:265	-	B:430
6	B:317	-	B:367
7	C:203	-	C:407
8	C:265	-	C:430
9	C:317	-	C:367

Asymmetric Unit

No.	Residues
1	Ser A:70	-	Pro A:71
2	Arg A:176	-	Pro A:177
3	Tyr A:270	-	Asp A:271
4	Gly A:420	-	Pro A:421
5	Ser B:70	-	Pro B:71
6	Arg B:176	-	Pro B:177
7	Tyr B:270	-	Asp B:271
8	Gly B:420	-	Pro B:421
9	Ser C:70	-	Pro C:71
10	Arg C:176	-	Pro C:177
11	Tyr C:270	-	Asp C:271
12	Gly C:420	-	Pro C:421

Asymmetric Unit (1, 3)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_060692	V	265	A	BACE1_HUMAN	Polymorphism	28989503	A/B/C	V	252	A

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_060692	V	265	A	BACE1_HUMAN	Polymorphism	28989503	A	V	252	A

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_060692	V	265	A	BACE1_HUMAN	Polymorphism	28989503	B	V	252	A

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_060692	V	265	A	BACE1_HUMAN	Polymorphism	28989503	C	V	252	A

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (2, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PEPTIDASE_A1	PS51767	Peptidase family A1 domain profile.	BACE1_HUMAN	75-416	3	A:62-403 B:62-403 C:62-403
2	ASP_PROTEASE	PS00141	Eukaryotic and viral aspartyl proteases active site.	BACE1_HUMAN	90-101	3	A:77-88 B:77-88 C:77-88

Biological Unit 1 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PEPTIDASE_A1	PS51767	Peptidase family A1 domain profile.	BACE1_HUMAN	75-416	1	A:62-403 - -
2	ASP_PROTEASE	PS00141	Eukaryotic and viral aspartyl proteases active site.	BACE1_HUMAN	90-101	1	A:77-88 - -

Biological Unit 2 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PEPTIDASE_A1	PS51767	Peptidase family A1 domain profile.	BACE1_HUMAN	75-416	1	- B:62-403 -
2	ASP_PROTEASE	PS00141	Eukaryotic and viral aspartyl proteases active site.	BACE1_HUMAN	90-101	1	- B:77-88 -

Biological Unit 3 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PEPTIDASE_A1	PS51767	Peptidase family A1 domain profile.	BACE1_HUMAN	75-416	1	- - C:62-403
2	ASP_PROTEASE	PS00141	Eukaryotic and viral aspartyl proteases active site.	BACE1_HUMAN	90-101	1	- - C:77-88

Asymmetric Unit (9, 27)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1b	ENST00000313005	1b	ENSE00002169377	chr11:117186972-117186251	722	BACE1_HUMAN	1-87	87	3	A:46-74 B:46-74 C:46-74	29 29 29
1.2d	ENST00000313005	2d	ENSE00001779698	chr11:117167677-117167589	89	BACE1_HUMAN	88-117	30	3	A:75-104 B:75-104 C:75-104	30 30 30
1.4c	ENST00000313005	4c	ENSE00001602221	chr11:117166063-117165847	217	BACE1_HUMAN	117-189	73	3	A:104-176 B:104-176 C:104-176	73 73 73
1.5b	ENST00000313005	5b	ENSE00001732292	chr11:117164724-117164587	138	BACE1_HUMAN	190-235	46	3	A:177-222 (gaps) B:177-222 (gaps) C:177-222 (gaps)	46 46 46
1.6b	ENST00000313005	6b	ENSE00001231658	chr11:117163904-117163770	135	BACE1_HUMAN	236-280	45	3	A:223-267 B:223-267 C:223-267	45 45 45
1.7c	ENST00000313005	7c	ENSE00001053358	chr11:117162529-117162428	102	BACE1_HUMAN	281-314	34	3	A:268-301 B:268-301 C:268-301	34 34 34
1.8b	ENST00000313005	8b	ENSE00001053366	chr11:117161765-117161616	150	BACE1_HUMAN	315-364	50	3	A:302-351 B:302-351 C:302-351	50 50 50
1.9d	ENST00000313005	9d	ENSE00001385289	chr11:117161375-117161204	172	BACE1_HUMAN	365-422	58	3	A:352-409 (gaps) B:352-409 (gaps) C:352-409 (gaps)	58 58 58
1.10f	ENST00000313005	10f	ENSE00002041784	chr11:117160523-117156402	4122	BACE1_HUMAN	422-501	80	3	A:409-433 B:409-433 C:409-433	25 25 25

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:373
 aligned with BACE1_HUMAN | P56817 from UniProtKB/Swiss-Prot  Length:501

    Alignment length:388
                                    68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438        
          BACE1_HUMAN    59 SFVEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTYRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFINGSNWEGILGLAYAEIARPDDSLEPFFDSLVKQTHVPNLFSLQLCGAGFPLNQSEVLASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKKVFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMGEVTNQSFRITILPQQYLRPVEDVATSQDDCYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRIGFAVSACHVHDEFRTAAVEGPFVTLDMEDCGYN 446
               SCOP domains d3ixka_ A: beta-secretase (memapsin)                                                                                                                                                                                                                                                                                                                                                                 SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhh...eee......eeeeee....eeeeeeee.....eeee...........hhhhh...eeeeeeeeeee..eeeeeeeeeeeee........eeeeeeeeeeee..........eeee..hhhhh.......hhhhhhhhhh.....eeeeee..-----------.eeeeeee...hhh.eeeeeeeee.......ee.eeeeee..ee...hhhhhhh..eee......eeeehhhhhhhhhhhhhhh...............eeee....hhhhh..eeeeee.....eeeeeeehhhhheee..----..eeeeee.eeee...eeehhhhhh.eeeeee....eeeeeee...........eeeeeee..hhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------A------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----------------PEPTIDASE_A1  PDB: A:62-403 UniProt: 75-416                                                                                                                                                                                                                                                                                                           ------------------------------ PROSITE (1)
                PROSITE (2) -------------------------------ASP_PROTEASE--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.1b  PDB: A:46-74      Exon 1.2d  PDB: A:75-104      ------------------------------------------------------------------------Exon 1.5b  PDB: A:177-222 (gaps)              Exon 1.6b  PDB: A:223-267 UniProt: 236-280   Exon 1.7c  PDB: A:268-301         Exon 1.8b  PDB: A:302-351 UniProt: 315-364        ---------------------------------------------------------Exon 1.10f  PDB: A:409-43 Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------Exon 1.4c  PDB: A:104-176 UniProt: 117-189                               -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.9d  PDB: A:352-409 (gaps) UniProt: 365-422         ------------------------ Transcript 1 (2)
                 3ixk A  46 SFVEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTYRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFINGSNWEGILGLAYAEIARPDDSLEPFFDSLVKQTHVPNLFSLQLCGA-----------SVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKKVFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMGEVTNQSFRITILPQQYLRPVE----SQDDCYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRIGFAVSACHVHDEFRTAAVEGPFVTLDMEDCGYN 433
                                    55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205         - |     225       235       245       255       265       275       285       295       305       315       325       335       345       355  |    365       375       385       395       405       415       425        
                                                                                                                                                                                         205         217                                                                                                                                          358  363

Chain B from PDB  Type:PROTEIN  Length:373
 aligned with BACE1_HUMAN | P56817 from UniProtKB/Swiss-Prot  Length:501

    Alignment length:388
                                    68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438        
          BACE1_HUMAN    59 SFVEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTYRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFINGSNWEGILGLAYAEIARPDDSLEPFFDSLVKQTHVPNLFSLQLCGAGFPLNQSEVLASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKKVFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMGEVTNQSFRITILPQQYLRPVEDVATSQDDCYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRIGFAVSACHVHDEFRTAAVEGPFVTLDMEDCGYN 446
               SCOP domains d3ixkb_ B: beta-secretase (memapsin)                                                                                                                                                                                                                                                                                                                                                                 SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhh..eee......eeeeee....eeeeeeee.....eeee...........hhhhh...eeeeeeeeee....eeeeeeeeeeee........eeeeeeeeeeee..........eeee..hhhhh.......hhhhhhhhhh.....eeeeee..-----------.eeeeeee...hhh.eeeeeeeee.......ee.eeeeee..ee...hhhhh....eee......eeeehhhhhhhhhhhhhhh.....hhhhhhh...eeee....hhhhh..eeeee.......eeeeeehhhhheee..----..eeeeee.eeee...eeehhhhhh.eeeeeehhh.eeeeeee...........eeeeee...hhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------A------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----------------PEPTIDASE_A1  PDB: B:62-403 UniProt: 75-416                                                                                                                                                                                                                                                                                                           ------------------------------ PROSITE (1)
                PROSITE (2) -------------------------------ASP_PROTEASE--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.1b  PDB: B:46-74      Exon 1.2d  PDB: B:75-104      ------------------------------------------------------------------------Exon 1.5b  PDB: B:177-222 (gaps)              Exon 1.6b  PDB: B:223-267 UniProt: 236-280   Exon 1.7c  PDB: B:268-301         Exon 1.8b  PDB: B:302-351 UniProt: 315-364        ---------------------------------------------------------Exon 1.10f  PDB: B:409-43 Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------Exon 1.4c  PDB: B:104-176 UniProt: 117-189                               -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.9d  PDB: B:352-409 (gaps) UniProt: 365-422         ------------------------ Transcript 1 (2)
                 3ixk B  46 SFVEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTYRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFINGSNWEGILGLAYAEIARPDDSLEPFFDSLVKQTHVPNLFSLQLCGA-----------SVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKKVFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMGEVTNQSFRITILPQQYLRPVE----SQDDCYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRIGFAVSACHVHDEFRTAAVEGPFVTLDMEDCGYN 433
                                    55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205         - |     225       235       245       255       265       275       285       295       305       315       325       335       345       355  |    365       375       385       395       405       415       425        
                                                                                                                                                                                         205         217                                                                                                                                          358  363

Chain C from PDB  Type:PROTEIN  Length:371
 aligned with BACE1_HUMAN | P56817 from UniProtKB/Swiss-Prot  Length:501

    Alignment length:388
                                    68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438        
          BACE1_HUMAN    59 SFVEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTYRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFINGSNWEGILGLAYAEIARPDDSLEPFFDSLVKQTHVPNLFSLQLCGAGFPLNQSEVLASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKKVFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMGEVTNQSFRITILPQQYLRPVEDVATSQDDCYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRIGFAVSACHVHDEFRTAAVEGPFVTLDMEDCGYN 446
               SCOP domains d3ixkc_ C: beta-secretase (memapsin)                                                                                                                                                                                                                                                                                                                                                                 SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eee......eeeeee....eeeeeeee.....eeee...........hhhhh...eeeeeeeeee....eeeeeeeeeeee........eeeeeeeeeeee..........eeee..hhhhh.......hhhhhhhhhh.....eeeeee..-----------.eeeeeee...hhh.eeeeeeeee..........eeeeee..ee...hhhhhhh..eee......eeeehhhhhhhhhhhhhhh.....hhhhhh............hhhhh..eeeeee.....eeeeeeehhhhheee..------...eee.eeee...eeehhhhhh.eeeeeehhh.eeeeeee...........eeeeeee..hhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------A------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----------------PEPTIDASE_A1  PDB: C:62-403 UniProt: 75-416                                                                                                                                                                                                                                                                                                           ------------------------------ PROSITE (1)
                PROSITE (2) -------------------------------ASP_PROTEASE--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.1b  PDB: C:46-74      Exon 1.2d  PDB: C:75-104      ------------------------------------------------------------------------Exon 1.5b  PDB: C:177-222 (gaps)              Exon 1.6b  PDB: C:223-267 UniProt: 236-280   Exon 1.7c  PDB: C:268-301         Exon 1.8b  PDB: C:302-351 UniProt: 315-364        ---------------------------------------------------------Exon 1.10f  PDB: C:409-43 Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------Exon 1.4c  PDB: C:104-176 UniProt: 117-189                               -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.9d  PDB: C:352-409 (gaps) UniProt: 365-422         ------------------------ Transcript 1 (2)
                 3ixk C  46 SFVEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTYRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFINGSNWEGILGLAYAEIARPDDSLEPFFDSLVKQTHVPNLFSLQLCGA-----------SVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKKVFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMGEVTNQSFRITILPQQYLRPVE------DDCYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRIGFAVSACHVHDEFRTAAVEGPFVTLDMEDCGYN 433
                                    55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205         - |     225       235       245       255       265       275       285       295       305       315       325       335       345       355  |    365       375       385       395       405       415       425        
                                                                                                                                                                                         205         217                                                                                                                                          358    365

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: Acid proteases (1120)

Superfamily: Acid proteases (1120)

Family: Pepsin-like (505)

Protein domain: beta-secretase (memapsin) (237)

Human (Homo sapiens) [TaxId: 9606] (237)

1a	d3ixka_	A:
1b	d3ixkb_	B:
1c	d3ixkc_	C:

(no "CATH Domain" information available for 3IXK)

(no "Pfam Domain" information available for 3IXK)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C (BACE1_HUMAN | P56817)

molecular function
	GO:0001540	amyloid-beta binding	Interacting selectively and non-covalently with amyloid-beta peptide/protein and/or its precursor.
	GO:0004190	aspartic-type endopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a mechanism in which a water molecule bound by the side chains of aspartic residues at the active center acts as a nucleophile.
	GO:0008798	beta-aspartyl-peptidase activity	Catalysis of the cleavage of a beta-linked aspartic residue from the N-terminus of a polypeptide.
	GO:0004175	endopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
	GO:0019899	enzyme binding	Interacting selectively and non-covalently with any enzyme.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0008233	peptidase activity	Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0050435	amyloid-beta metabolic process	The chemical reactions and pathways involving amyloid-beta, a glycoprotein associated with Alzheimer's disease, and its precursor, amyloid precursor protein (APP).
	GO:0044267	cellular protein metabolic process	The chemical reactions and pathways involving a specific protein, rather than of proteins in general, occurring at the level of an individual cell. Includes cellular protein modification.
	GO:0006509	membrane protein ectodomain proteolysis	The proteolytic cleavage of transmembrane proteins and release of their ectodomain (extracellular domain).
	GO:0030163	protein catabolic process	The chemical reactions and pathways resulting in the breakdown of a protein by the destruction of the native, active configuration, with or without the hydrolysis of peptide bonds.
	GO:0006508	proteolysis	The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
cellular component
	GO:0005794	Golgi apparatus	A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
	GO:0070931	Golgi-associated vesicle lumen	The volume enclosed by the membrane of a Golgi-associated vesicle.
	GO:0030424	axon	The long process of a neuron that conducts nerve impulses, usually away from the cell body to the terminals and varicosities, which are sites of storage and release of neurotransmitter.
	GO:0009986	cell surface	The external part of the cell wall and/or plasma membrane.
	GO:0031410	cytoplasmic vesicle	A vesicle found in the cytoplasm of a cell.
	GO:0030659	cytoplasmic vesicle membrane	The lipid bilayer surrounding a cytoplasmic vesicle.
	GO:0005783	endoplasmic reticulum	The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
	GO:0005788	endoplasmic reticulum lumen	The volume enclosed by the membranes of the endoplasmic reticulum.
	GO:0005768	endosome	A vacuole to which materials ingested by endocytosis are delivered.
	GO:0010008	endosome membrane	The lipid bilayer surrounding an endosome.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005770	late endosome	A prelysosomal endocytic organelle differentiated from early endosomes by lower lumenal pH and different protein composition. Late endosomes are more spherical than early endosomes and are mostly juxtanuclear, being concentrated near the microtubule organizing center.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005771	multivesicular body	A type of endosome in which regions of the limiting endosomal membrane invaginate to form internal vesicles; membrane proteins that enter the internal vesicles are sequestered from the cytoplasm.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0005802	trans-Golgi network	The network of interconnected tubular and cisternal structures located within the Golgi apparatus on the side distal to the endoplasmic reticulum, from which secretory vesicles emerge. The trans-Golgi network is important in the later stages of protein secretion where it is thought to play a key role in the sorting and targeting of secreted proteins to the correct destination.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		929	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Arg A:176 - Pro A:177	[ RasMol ]
		Arg B:176 - Pro B:177	[ RasMol ]
		Arg C:176 - Pro C:177	[ RasMol ]
		Gly A:420 - Pro A:421	[ RasMol ]
		Gly B:420 - Pro B:421	[ RasMol ]
		Gly C:420 - Pro C:421	[ RasMol ]
		Ser A:70 - Pro A:71	[ RasMol ]
		Ser B:70 - Pro B:71	[ RasMol ]
		Ser C:70 - Pro C:71	[ RasMol ]
		Tyr A:270 - Asp A:271	[ RasMol ]
		Tyr B:270 - Asp B:271	[ RasMol ]
		Tyr C:270 - Asp C:271	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3ixk
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	BACE1_HUMAN \| P56817
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.4.23.46
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	BACE1_HUMAN \| P56817
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Related Entries Specified in the PDB File" available for 3IXK)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 3)

Sites (3, 3)

SS Bonds (9, 9)

Cis Peptide Bonds (12, 12)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 3)

PROSITE Motifs (2, 6)

Exons (9, 27)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 3)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (30, 30)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File