|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 2)
|
Asymmetric Unit (2, 2)
|
(no "SS Bond" information available for 3IQL) |
(no "Cis Peptide Bond" information available for 3IQL) |
(no "SAP(SNP)/Variant" information available for 3IQL) |
Asymmetric Unit (1, 2)
|
Asymmetric Unit (1, 2)
|
Asymmetric UnitChain A from PDB Type:PROTEIN Length:66 aligned with SH3G2_RAT | O35179 from UniProtKB/Swiss-Prot Length:352 Alignment length:66 296 306 316 326 336 346 SH3G2_RAT 287 GVQMDQPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGQSGFFPINYVEILVALPH 352 SCOP domains d3iqla_ A: automated matches SCOP domains CATH domains ------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs) PROSITE ---SH3 PDB: A:291-349 UniProt: 290-349 --- PROSITE Transcript 1 Exon 1.9 PDB: A:287-338 UniProt: 273-338 -------------- Transcript 1 3iql A 287 SVGSDQPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGQSGFFPINYVEILVALPH 352 296 306 316 326 336 346 Chain B from PDB Type:PROTEIN Length:67 aligned with SH3G2_RAT | O35179 from UniProtKB/Swiss-Prot Length:352 Alignment length:67 295 305 315 325 335 345 SH3G2_RAT 286 AGVQMDQPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGQSGFFPINYVEILVALPH 352 SCOP domains d3iqlb_ B: automated matches SCOP domains CATH domains ------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------- SAPs(SNPs) PROSITE ----SH3 PDB: B:291-349 UniProt: 290-349 --- PROSITE Transcript 1 Exon 1.9 PDB: B:286-338 UniProt: 273-338 -------------- Transcript 1 3iql B 286 ASVGSDQPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGQSGFFPINYVEILVALPH 352 295 305 315 325 335 345
|
Asymmetric Unit
|
(no "CATH Domain" information available for 3IQL) |
(no "Pfam Domain" information available for 3IQL) |
Asymmetric Unit(hide GO term definitions) Chain A,B (SH3G2_RAT | O35179)
|
|
|
|
|
|
|