3HQC - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF PHOSPHOTYROSINE-BINDING DOMAIN FROM THE HUMAN TENSIN-LIKE C1 DOMAIN-CONTAINING PHOSPHATASE (TENC1)

Authors :   P. Sampathkumar, R. Romero, S. Wasserman, J. Do, M. Dickey, K. Bain, T. G R. Klemke, S. Atwell, J. M. Sauder, S. K. Burley, New York Sgx Resear For Structural Genomics (Nysgxrc)

Date :   05 Jun 09 (Deposition) - 21 Jul 09 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.80

Chains :   Asym./Biol. Unit : A

Keywords :   Human Tensin-Like C1 Domain-Containing Phosphatase, Tenc1, Phosphotyrosine Binding Domain, Ptb, Tns2, Kiaa1075, Structural Genomics, Psi-2, Protein Structure Initiative, New York Sgx Research Center For Structural Genomics, Nysgxrc, Cell Junction, Cell Membrane, Hydrolase, Membrane, Metal-Binding, Phorbol-Ester Binding, Phosphoprotein, Protein Phosphatase, Sh2 Domain, Zinc-Finger (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   P. Sampathkumar, R. Romero, S. Wasserman, J. Do, M. Dickey, K. Bain, T. Gheyi, R. Klemke, S. Atwell, J. M. Sauder, S. K. Burley
Crystal Structure Of Phosphotyrosine-Binding Domain From Th Human Tensin-Like C1 Domain-Containing Phosphatase (Tenc1)
To Be Published
PubMed: search

Molecule 1 - TENSIN-LIKE C1 DOMAIN-CONTAINING PHOSPHATASE
	Chains	:	A
	EC Number	:	3.1.3.-
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	BC-PSGX3(BC); MODIFIED PET26B
	Expression System Strain	:	BL21(DE3)-CODON+RIL
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Fragment	:	PHOSPHOTYROSINE BINDING DOMAIN, PTB, RESIDUES 1264-1409
	Gene	:	KIAA1075, TENC1, TNS2
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	TENC1, C1 DOMAIN-CONTAINING PHOSPHATASE AND TENSIN HOMOLOG, C1-TEN, TENSIN-2

		1
Asymmetric/Biological Unit	:	A

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (4, 7)

No.	Name	Count	Type	Full Name
1	ACT	2	Ligand/Ion	ACETATE ION
2	GOL	1	Ligand/Ion	GLYCEROL
3	MSE	1	Mod. Amino Acid	SELENOMETHIONINE
4	SO4	3	Ligand/Ion	SULFATE ION

Asymmetric Unit (6, 6)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	HOH A:21 , HOH A:30 , HOH A:59 , CYS A:1276 , SER A:1277 , ARG A:1335 , HIS A:1337 , ASP A:1388	BINDING SITE FOR RESIDUE SO4 A 1
2	AC2	SOFTWARE	LYS A:1317 , ARG A:1335 , LYS A:1372 , GLY A:1374 , ASP A:1388 , GLN A:1391	BINDING SITE FOR RESIDUE SO4 A 2
3	AC3	SOFTWARE	HOH A:28 , HOH A:70 , HIS A:1315 , LYS A:1317 , ARG A:1336 , LYS A:1372 , PRO A:1373 , GLY A:1374	BINDING SITE FOR RESIDUE SO4 A 3
4	AC4	SOFTWARE	ALA A:1274 , ALA A:1275 , CYS A:1276 , ARG A:1335 , GLN A:1391	BINDING SITE FOR RESIDUE ACT A 1418
5	AC5	SOFTWARE	GLY A:1273 , ALA A:1274 , VAL A:1318 , PHE A:1333 , VAL A:1403	BINDING SITE FOR RESIDUE ACT A 1419
6	AC6	SOFTWARE	HOH A:66 , HOH A:78 , GLU A:1386 , PRO A:1392 , GLY A:1394 , ALA A:1395	BINDING SITE FOR RESIDUE GOL A 1420

(no "SS Bond" information available for 3HQC)

(no "Cis Peptide Bond" information available for 3HQC)

(no "SAP(SNP)/Variant" information available for 3HQC)

(no "PROSITE Motif" information available for 3HQC)

Asymmetric/Biological Unit (5, 5)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.3	ENST00000314250	3	ENSE00002176967	chr12:53443680-53444044	365	TNS2_HUMAN	1-25	25	0	-	-
1.4	ENST00000314250	4	ENSE00001702661	chr12:53445639-53445747	109	TNS2_HUMAN	26-62	37	0	-	-
1.5	ENST00000314250	5	ENSE00001602732	chr12:53446239-53446276	38	TNS2_HUMAN	62-74	13	0	-	-
1.6	ENST00000314250	6	ENSE00001706663	chr12:53447195-53447233	39	TNS2_HUMAN	75-87	13	0	-	-
1.7	ENST00000314250	7	ENSE00001646683	chr12:53447558-53447596	39	TNS2_HUMAN	88-100	13	0	-	-
1.8	ENST00000314250	8	ENSE00001602842	chr12:53447749-53447798	50	TNS2_HUMAN	101-117	17	0	-	-
1.9	ENST00000314250	9	ENSE00001622467	chr12:53448054-53448225	172	TNS2_HUMAN	117-174	58	0	-	-
1.10	ENST00000314250	10	ENSE00000838131	chr12:53448970-53449020	51	TNS2_HUMAN	175-191	17	0	-	-
1.11a	ENST00000314250	11a	ENSE00000938905	chr12:53449352-53449474	123	TNS2_HUMAN	192-232	41	0	-	-
1.11c	ENST00000314250	11c	ENSE00000838133	chr12:53449565-53449629	65	TNS2_HUMAN	233-254	22	0	-	-
1.12	ENST00000314250	12	ENSE00000838134	chr12:53450797-53450880	84	TNS2_HUMAN	254-282	29	0	-	-
1.13	ENST00000314250	13	ENSE00000746463	chr12:53451351-53451463	113	TNS2_HUMAN	282-320	39	0	-	-
1.14	ENST00000314250	14	ENSE00000746465	chr12:53451557-53451617	61	TNS2_HUMAN	320-340	21	0	-	-
1.15	ENST00000314250	15	ENSE00000746467	chr12:53451811-53451886	76	TNS2_HUMAN	340-365	26	0	-	-
1.16	ENST00000314250	16	ENSE00000746468	chr12:53452100-53452229	130	TNS2_HUMAN	366-409	44	0	-	-
1.17	ENST00000314250	17	ENSE00000746469	chr12:53452356-53452421	66	TNS2_HUMAN	409-431	23	0	-	-
1.18	ENST00000314250	18	ENSE00000746470	chr12:53452498-53452611	114	TNS2_HUMAN	431-469	39	0	-	-
1.19c	ENST00000314250	19c	ENSE00000746471	chr12:53452831-53454042	1212	TNS2_HUMAN	469-873	405	0	-	-
1.20	ENST00000314250	20	ENSE00000746472	chr12:53454189-53454339	151	TNS2_HUMAN	873-923	51	0	-	-
1.21	ENST00000314250	21	ENSE00000746473	chr12:53454459-53455048	590	TNS2_HUMAN	923-1120	198	0	-	-
1.22	ENST00000314250	22	ENSE00000491479	chr12:53455164-53455253	90	TNS2_HUMAN	1120-1150	31	0	-	-
1.23	ENST00000314250	23	ENSE00000746475	chr12:53455599-53455724	126	TNS2_HUMAN	1150-1192	43	0	-	-
1.24	ENST00000314250	24	ENSE00000746476	chr12:53455937-53456029	93	TNS2_HUMAN	1192-1223	32	0	-	-
1.25	ENST00000314250	25	ENSE00000746477	chr12:53456160-53456237	78	TNS2_HUMAN	1223-1249	27	0	-	-
1.26b	ENST00000314250	26b	ENSE00000838135	chr12:53456404-53456481	78	TNS2_HUMAN	1249-1275	27	1	A:1264-1275	12
1.27a	ENST00000314250	27a	ENSE00000838136	chr12:53456873-53457041	169	TNS2_HUMAN	1275-1331	57	1	A:1275-1331 (gaps)	57
1.28	ENST00000314250	28	ENSE00000746494	chr12:53457133-53457201	69	TNS2_HUMAN	1331-1354	24	1	A:1331-1354	24
1.29	ENST00000314250	29	ENSE00000746496	chr12:53457347-53457376	30	TNS2_HUMAN	1354-1364	11	1	A:1354-1364	11
1.30a	ENST00000314250	30a	ENSE00001411522	chr12:53457528-53458155	628	TNS2_HUMAN	1364-1409	46	1	A:1364-1406	43

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:140
 aligned with TNS2_HUMAN | Q63HR2 from UniProtKB/Swiss-Prot  Length:1409

    Alignment length:143
                                  1273      1283      1293      1303      1313      1323      1333      1343      1353      1363      1373      1383      1393      1403   
          TNS2_HUMAN   1264 STAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAALSCSPRPTPAVVHFKVSAQGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNPDGTTSKIFGFVAKKPGSPWENVCHLFAELDPDQPAGAIVTFITKVLLG 1406
               SCOP domains d3hqca_ A: automated matches                                                                                                                    SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhheeeeeeeeeeee....hhhhhhhhhhhhhhhh.---..eeeeeeee..eeeeeeee..eeeeeeee...eeeeee.....eee.....eeeeeeeeeee..eeeeeeeeeee......hhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.26b  -------------------------------------------------------Exon 1.28               ---------Exon 1.30a  PDB: A:1364-1406 [INCOMPLETE]   Transcript 1 (1)
           Transcript 1 (2) -----------Exon 1.27a  PDB: A:1275-1331 (gaps) UniProt: 1275-1331   ----------------------Exon 1.29  ------------------------------------------ Transcript 1 (2)
                3hqc A 1264 STAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAALSCS---TPAVVHFKVSAQGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNPDGTTSKIFGFVAKKPGSPWENVCHLFAELDPDQPAGAIVTFITKVmLG 1406
                                  1273      1283      1293      1303  |   1313      1323      1333      1343      1353      1363      1373      1383      1393      1403|  
                                                                   1306   |                                                                                          1404-MSE
                                                                       1310

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: PH domain-like barrel (258)

Superfamily: PH domain-like (257)

Family: Phosphotyrosine-binding domain (PTB) (31)

Protein domain: automated matches (6)

Human (Homo sapiens) [TaxId: 9606] (3)

d3hqca_

(no "CATH Domain" information available for 3HQC)

(no "Pfam Domain" information available for 3HQC)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (TNS2_HUMAN | Q63HR2)

molecular function
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0019900	kinase binding	Interacting selectively and non-covalently with a kinase, any enzyme that catalyzes the transfer of a phosphate group.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0004721	phosphoprotein phosphatase activity	Catalysis of the reaction: a phosphoprotein + H2O = a protein + phosphate. Together with protein kinases, these enzymes control the state of phosphorylation of cell proteins and thereby provide an important mechanism for regulating cellular activity.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0019725	cellular homeostasis	Any process involved in the maintenance of an internal steady state at the level of the cell.
	GO:0032963	collagen metabolic process	The chemical reactions and pathways involving collagen, any of a group of fibrous proteins of very high tensile strength that form the main component of connective tissue in animals. Collagen is highly enriched in glycine (some regions are 33% glycine) and proline, occurring predominantly as 3-hydroxyproline (about 20%).
	GO:0035556	intracellular signal transduction	The process in which a signal is passed on to downstream components within the cell, which become activated themselves to further propagate the signal and finally trigger a change in the function or state of the cell.
	GO:0001822	kidney development	The process whose specific outcome is the progression of the kidney over time, from its formation to the mature structure. The kidney is an organ that filters the blood and/or excretes the end products of body metabolism in the form of urine.
	GO:0035264	multicellular organism growth	The increase in size or mass of an entire multicellular organism, as opposed to cell growth.
	GO:0048871	multicellular organismal homeostasis	Any process involved in the maintenance of an internal steady state at the level of the multicellular organism.
	GO:0008285	negative regulation of cell proliferation	Any process that stops, prevents or reduces the rate or extent of cell proliferation.
	GO:0006470	protein dephosphorylation	The process of removing one or more phosphoric residues from a protein.
	GO:0014850	response to muscle activity	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a muscle activity stimulus.
cellular component
	GO:0030054	cell junction	A cellular component that forms a specialized region of connection between two or more cells or between a cell and the extracellular matrix. At a cell junction, anchoring proteins extend through the plasma membrane to link cytoskeletal proteins in one cell to cytoskeletal proteins in neighboring cells or to proteins in the extracellular matrix.
	GO:0005925	focal adhesion	Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		ACT	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		GOL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MSE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3hqc)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3hqc
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	TNS2_HUMAN \| Q63HR2
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.1.3.-
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	TNS2_HUMAN \| Q63HR2
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	TNS2_HUMAN \| Q63HR2	:	2dkq 2kno 2l6k 2loz

(no "Related Entries Specified in the PDB File" available for 3HQC)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (4, 7)

Sites (6, 6)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (5, 5)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (19, 19)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File