2LOZ - JenaLib

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   THE NOVEL BINDING MODE OF DLC1 AND TENSIN2 PTB DOMAIN

Authors :   C. Liu, L. Chen, G. Zhu

Date :   29 Jan 12 (Deposition) - 06 Jun 12 (Release) - 06 Jun 12 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A,B  (10x)
NMR Structure *: A,B  (1x)

Keywords :   Ptb, Dlc1, Hydrolase-Hydrolase Activator Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   L. Chen, C. Liu, F. C. F. Ko, N. Xu, I. O. -L. Ng, J. W. P. Yam, G. Zhu
Solution Structure Of The Ptb Domain Of Human Tensin2 In Complex With Deleted In Liver Cancer 1 (Dlc1) Peptide Reveals A Novel Peptide Binding Mode
J. Biol. Chem. 2012
PubMed: search | Reference-DOI: 10.1074/JBC.M112.360206

Molecule 1 - TENSIN-LIKE C1 DOMAIN-CONTAINING PHOSPHATASE
	Chains	:	A
	EC Number	:	3.1.3.-
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Expression System Vector	:	PET
	Fragment	:	PTB DOMAIN, UNP RESIDUES 1263-1409
	Gene	:	TENC1
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	C1 DOMAIN-CONTAINING PHOSPHATASE AND TENSIN HOMOLOG, C1-TEN, TENSIN-2

Molecule 2 - RHO GTPASE-ACTIVATING PROTEIN 7
	Chains	:	B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Expression System Vector	:	PET
	Fragment	:	UNP RESIDUES 811-824
	Gene	:	DLC1
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	DELETED IN LIVER CANCER 1 PROTEIN, DLC-1, HP PROTEIN, RHO- TYPE GTPASE-ACTIVATING PROTEIN 7, START DOMAIN-CONTAINING PROTEIN 12, STARD12, STAR-RELATED LIPID TRANSFER PROTEIN 12

		1	2
NMR Structure (10x)	:	A	B
NMR Structure * (1x)	:	A	B

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2LOZ)

(no "Site" information available for 2LOZ)

(no "SS Bond" information available for 2LOZ)

(no "Cis Peptide Bond" information available for 2LOZ)

(no "SAP(SNP)/Variant" information available for 2LOZ)

(no "PROSITE Motif" information available for 2LOZ)

NMR Structure (6, 6)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.2b	ENST00000276297	2b	ENSE00001189213	chr8:13372395-13372111	285	RHG07_HUMAN	-	0	0	-	-
1.3b	ENST00000276297	3b	ENSE00001388926	chr8:13357705-13356558	1148	RHG07_HUMAN	1-341	341	0	-	-
1.4	ENST00000276297	4	ENSE00000979612	chr8:13259128-13258979	150	RHG07_HUMAN	342-391	50	0	-	-
1.5b	ENST00000276297	5b	ENSE00001015479	chr8:13251202-13251062	141	RHG07_HUMAN	392-438	47	0	-	-
1.6a	ENST00000276297	6a	ENSE00001087081	chr8:13162811-13162778	34	RHG07_HUMAN	439-450	12	0	-	-
1.12	ENST00000276297	12	ENSE00001189219	chr8:12973166-12973095	72	RHG07_HUMAN	450-474	25	0	-	-
1.13	ENST00000276297	13	ENSE00001087061	chr8:12968332-12968251	82	RHG07_HUMAN	474-501	28	0	-	-
1.14	ENST00000276297	14	ENSE00001087065	chr8:12960362-12960299	64	RHG07_HUMAN	501-522	22	0	-	-
1.15e	ENST00000276297	15e	ENSE00001087057	chr8:12958279-12956856	1424	RHG07_HUMAN	523-997	475	1	B:367-380	14
1.16	ENST00000276297	16	ENSE00001087059	chr8:12956084-12955908	177	RHG07_HUMAN	997-1056	60	0	-	-
1.18	ENST00000276297	18	ENSE00001087055	chr8:12952754-12952595	160	RHG07_HUMAN	1056-1109	54	0	-	-
1.19c	ENST00000276297	19c	ENSE00001087071	chr8:12952466-12952268	199	RHG07_HUMAN	1110-1176	67	0	-	-
1.20	ENST00000276297	20	ENSE00001087051	chr8:12950334-12950121	214	RHG07_HUMAN	1176-1247	72	0	-	-
1.21	ENST00000276297	21	ENSE00001087050	chr8:12948941-12948827	115	RHG07_HUMAN	1247-1285	39	0	-	-
1.22	ENST00000276297	22	ENSE00001087069	chr8:12947979-12947761	219	RHG07_HUMAN	1286-1358	73	0	-	-
1.23b	ENST00000276297	23b	ENSE00001087054	chr8:12946213-12945996	218	RHG07_HUMAN	1359-1431	73	0	-	-
1.24a	ENST00000276297	24a	ENSE00001087052	chr8:12943972-12943799	174	RHG07_HUMAN	1431-1489	59	0	-	-
1.25e	ENST00000276297	25e	ENSE00001216909	chr8:12943440-12940870	2571	RHG07_HUMAN	1489-1528	40	0	-	-

2.3	ENST00000314250	3	ENSE00002176967	chr12:53443680-53444044	365	TNS2_HUMAN	1-25	25	0	-	-
2.4	ENST00000314250	4	ENSE00001702661	chr12:53445639-53445747	109	TNS2_HUMAN	26-62	37	0	-	-
2.5	ENST00000314250	5	ENSE00001602732	chr12:53446239-53446276	38	TNS2_HUMAN	62-74	13	0	-	-
2.6	ENST00000314250	6	ENSE00001706663	chr12:53447195-53447233	39	TNS2_HUMAN	75-87	13	0	-	-
2.7	ENST00000314250	7	ENSE00001646683	chr12:53447558-53447596	39	TNS2_HUMAN	88-100	13	0	-	-
2.8	ENST00000314250	8	ENSE00001602842	chr12:53447749-53447798	50	TNS2_HUMAN	101-117	17	0	-	-
2.9	ENST00000314250	9	ENSE00001622467	chr12:53448054-53448225	172	TNS2_HUMAN	117-174	58	0	-	-
2.10	ENST00000314250	10	ENSE00000838131	chr12:53448970-53449020	51	TNS2_HUMAN	175-191	17	0	-	-
2.11a	ENST00000314250	11a	ENSE00000938905	chr12:53449352-53449474	123	TNS2_HUMAN	192-232	41	0	-	-
2.11c	ENST00000314250	11c	ENSE00000838133	chr12:53449565-53449629	65	TNS2_HUMAN	233-254	22	0	-	-
2.12	ENST00000314250	12	ENSE00000838134	chr12:53450797-53450880	84	TNS2_HUMAN	254-282	29	0	-	-
2.13	ENST00000314250	13	ENSE00000746463	chr12:53451351-53451463	113	TNS2_HUMAN	282-320	39	0	-	-
2.14	ENST00000314250	14	ENSE00000746465	chr12:53451557-53451617	61	TNS2_HUMAN	320-340	21	0	-	-
2.15	ENST00000314250	15	ENSE00000746467	chr12:53451811-53451886	76	TNS2_HUMAN	340-365	26	0	-	-
2.16	ENST00000314250	16	ENSE00000746468	chr12:53452100-53452229	130	TNS2_HUMAN	366-409	44	0	-	-
2.17	ENST00000314250	17	ENSE00000746469	chr12:53452356-53452421	66	TNS2_HUMAN	409-431	23	0	-	-
2.18	ENST00000314250	18	ENSE00000746470	chr12:53452498-53452611	114	TNS2_HUMAN	431-469	39	0	-	-
2.19c	ENST00000314250	19c	ENSE00000746471	chr12:53452831-53454042	1212	TNS2_HUMAN	469-873	405	0	-	-
2.20	ENST00000314250	20	ENSE00000746472	chr12:53454189-53454339	151	TNS2_HUMAN	873-923	51	0	-	-
2.21	ENST00000314250	21	ENSE00000746473	chr12:53454459-53455048	590	TNS2_HUMAN	923-1120	198	0	-	-
2.22	ENST00000314250	22	ENSE00000491479	chr12:53455164-53455253	90	TNS2_HUMAN	1120-1150	31	0	-	-
2.23	ENST00000314250	23	ENSE00000746475	chr12:53455599-53455724	126	TNS2_HUMAN	1150-1192	43	0	-	-
2.24	ENST00000314250	24	ENSE00000746476	chr12:53455937-53456029	93	TNS2_HUMAN	1192-1223	32	0	-	-
2.25	ENST00000314250	25	ENSE00000746477	chr12:53456160-53456237	78	TNS2_HUMAN	1223-1249	27	0	-	-
2.26b	ENST00000314250	26b	ENSE00000838135	chr12:53456404-53456481	78	TNS2_HUMAN	1249-1275	27	1	A:1263-1275	13
2.27a	ENST00000314250	27a	ENSE00000838136	chr12:53456873-53457041	169	TNS2_HUMAN	1275-1331	57	1	A:1275-1331	57
2.28	ENST00000314250	28	ENSE00000746494	chr12:53457133-53457201	69	TNS2_HUMAN	1331-1354	24	1	A:1331-1354	24
2.29	ENST00000314250	29	ENSE00000746496	chr12:53457347-53457376	30	TNS2_HUMAN	1354-1364	11	1	A:1354-1364	11
2.30a	ENST00000314250	30a	ENSE00001411522	chr12:53457528-53458155	628	TNS2_HUMAN	1364-1409	46	1	A:1364-1409	46

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:147
 aligned with TNS2_HUMAN | Q63HR2 from UniProtKB/Swiss-Prot  Length:1409

    Alignment length:147
                                  1272      1282      1292      1302      1312      1322      1332      1342      1352      1362      1372      1382      1392      1402       
          TNS2_HUMAN   1263 MSTAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAALSCSPRPTPAVVHFKVSAQGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNPDGTTSKIFGFVAKKPGSPWENVCHLFAELDPDQPAGAIVTFITKVLLGQRK 1409
               SCOP domains d2loza_ A: Tensin                                                                                                                                   SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhh...eeeeeeeeeee....hhhhhhhhhhhhhhhh......eeeeeeee..eeeee...........ee...eeeee......eee.....eeeeeeeeeee..eeeeeeeeeee......hhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.26b   -------------------------------------------------------Exon 2.28               ---------Exon 2.30a  PDB: A:1364-1409                   Transcript 2 (1)
           Transcript 2 (2) ------------Exon 2.27a  PDB: A:1275-1331 UniProt: 1275-1331          ----------------------Exon 2.29  --------------------------------------------- Transcript 2 (2)
                2loz A 1263 MSTAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAALSCSPRPTPAVVHFKVSAQGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNPDGTTSKIFGFVAKKPGSPWENVCHLFAELDPDQPAGAIVTFITKVLLGQRK 1409
                                  1272      1282      1292      1302      1312      1322      1332      1342      1352      1362      1372      1382      1392      1402

Chain B from PDB  Type:PROTEIN  Length:14
 aligned with RHG07_HUMAN | Q96QB1 from UniProtKB/Swiss-Prot  Length:1528

    Alignment length:14
                                   820    
         RHG07_HUMAN    811 EDHKPGTFPKALTN  824
               SCOP domains -------------- SCOP domains
               CATH domains -------------- CATH domains
               Pfam domains -------------- Pfam domains
         Sec.struct. author .............. Sec.struct. author
                 SAPs(SNPs) -------------- SAPs(SNPs)
                    PROSITE -------------- PROSITE
               Transcript 1 Exon 1.15e     Transcript 1
                2loz B  367 EDHKPGTFPKALTN  380
                                   376

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

NMR Structure

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: PH domain-like barrel (258)

Superfamily: PH domain-like (257)

Family: Phosphotyrosine-binding domain (PTB) (31)

Protein domain: Tensin (3)

Human (Homo sapiens) [TaxId: 9606] (2)

d2loza_

(no "CATH Domain" information available for 2LOZ)

(no "Pfam Domain" information available for 2LOZ)

NMR Structure(hide GO term definitions)

Chain A (TNS2_HUMAN | Q63HR2)

molecular function
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0019900	kinase binding	Interacting selectively and non-covalently with a kinase, any enzyme that catalyzes the transfer of a phosphate group.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0004721	phosphoprotein phosphatase activity	Catalysis of the reaction: a phosphoprotein + H2O = a protein + phosphate. Together with protein kinases, these enzymes control the state of phosphorylation of cell proteins and thereby provide an important mechanism for regulating cellular activity.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0019725	cellular homeostasis	Any process involved in the maintenance of an internal steady state at the level of the cell.
	GO:0032963	collagen metabolic process	The chemical reactions and pathways involving collagen, any of a group of fibrous proteins of very high tensile strength that form the main component of connective tissue in animals. Collagen is highly enriched in glycine (some regions are 33% glycine) and proline, occurring predominantly as 3-hydroxyproline (about 20%).
	GO:0035556	intracellular signal transduction	The process in which a signal is passed on to downstream components within the cell, which become activated themselves to further propagate the signal and finally trigger a change in the function or state of the cell.
	GO:0001822	kidney development	The process whose specific outcome is the progression of the kidney over time, from its formation to the mature structure. The kidney is an organ that filters the blood and/or excretes the end products of body metabolism in the form of urine.
	GO:0035264	multicellular organism growth	The increase in size or mass of an entire multicellular organism, as opposed to cell growth.
	GO:0048871	multicellular organismal homeostasis	Any process involved in the maintenance of an internal steady state at the level of the multicellular organism.
	GO:0008285	negative regulation of cell proliferation	Any process that stops, prevents or reduces the rate or extent of cell proliferation.
	GO:0006470	protein dephosphorylation	The process of removing one or more phosphoric residues from a protein.
	GO:0014850	response to muscle activity	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a muscle activity stimulus.
cellular component
	GO:0030054	cell junction	A cellular component that forms a specialized region of connection between two or more cells or between a cell and the extracellular matrix. At a cell junction, anchoring proteins extend through the plasma membrane to link cytoskeletal proteins in one cell to cytoskeletal proteins in neighboring cells or to proteins in the extracellular matrix.
	GO:0005925	focal adhesion	Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Chain B (RHG07_HUMAN | Q96QB1)

molecular function
	GO:0005096	GTPase activator activity	Binds to and increases the activity of a GTPase, an enzyme that catalyzes the hydrolysis of GTP.
	GO:0042169	SH2 domain binding	Interacting selectively and non-covalently with a SH2 domain (Src homology 2) of a protein, a protein domain of about 100 amino-acid residues and belonging to the alpha + beta domain class.
	GO:0008289	lipid binding	Interacting selectively and non-covalently with a lipid.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0030036	actin cytoskeleton organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments and their associated proteins.
	GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	Any process that initiates the activity of the inactive enzyme cysteine-type endopeptidase in the context of an apoptotic process.
	GO:0006915	apoptotic process	A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
	GO:0048041	focal adhesion assembly	The aggregation and bonding together of a set of components to form a focal adhesion, a complex of intracellular signaling and structural proteins that provides a structural link between the internal actin cytoskeleton and the ECM, and also function as a locus of signal transduction activity.
	GO:0030900	forebrain development	The process whose specific outcome is the progression of the forebrain over time, from its formation to the mature structure. The forebrain is the anterior of the three primary divisions of the developing chordate brain or the corresponding part of the adult brain (in vertebrates, includes especially the cerebral hemispheres, the thalamus, and the hypothalamus and especially in higher vertebrates is the main control center for sensory and associative information processing, visceral functions, and voluntary motor functions).
	GO:0003007	heart morphogenesis	The developmental process in which the heart is generated and organized. The heart is a hollow, muscular organ, which, by contracting rhythmically, keeps up the circulation of the blood.
	GO:0021575	hindbrain morphogenesis	The process in which the anatomical structure of the hindbrain is generated and organized. The hindbrain is the region consisting of the medulla, pons and cerebellum. Areas of the hindbrain control motor and autonomic functions.
	GO:0035024	negative regulation of Rho protein signal transduction	Any process that stops, prevents, or reduces the frequency, rate or extent of Rho protein signal transduction.
	GO:0030336	negative regulation of cell migration	Any process that stops, prevents, or reduces the frequency, rate or extent of cell migration.
	GO:0008285	negative regulation of cell proliferation	Any process that stops, prevents or reduces the rate or extent of cell proliferation.
	GO:0051895	negative regulation of focal adhesion assembly	Any process that stops, prevents, or reduces the frequency, rate or extent of focal adhesion assembly, the establishment and maturation of focal adhesions.
	GO:0051497	negative regulation of stress fiber assembly	Any process that stops, prevents, or reduces the frequency, rate or extent of the assembly a stress fiber, a bundle of microfilaments and other proteins found in fibroblasts.
	GO:0001843	neural tube closure	The last step in the formation of the neural tube, where the paired neural folds are brought together and fuse at the dorsal midline.
	GO:0043547	positive regulation of GTPase activity	Any process that activates or increases the activity of a GTPase.
	GO:1900119	positive regulation of execution phase of apoptosis	Any process that activates or increases the frequency, rate or extent of execution phase of apoptosis.
	GO:0035307	positive regulation of protein dephosphorylation	Any process that activates or increases the frequency, rate or extent of removal of phosphate groups from a protein.
	GO:0035023	regulation of Rho protein signal transduction	Any process that modulates the frequency, rate or extent of Rho protein signal transduction.
	GO:0032956	regulation of actin cytoskeleton organization	Any process that modulates the frequency, rate or extent of the formation, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments and their associated proteins.
	GO:0008360	regulation of cell shape	Any process that modulates the surface configuration of a cell.
	GO:0051056	regulation of small GTPase mediated signal transduction	Any process that modulates the frequency, rate or extent of small GTPase mediated signal transduction.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
	GO:0005901	caveola	A membrane raft that forms small pit, depression, or invagination that communicates with the outside of a cell and extends inward, indenting the cytoplasm and the cell membrane. Examples include flask-shaped invaginations of the plasma membrane in adipocytes associated with caveolin proteins, and minute pits or incuppings of the cell membrane formed during pinocytosis. Caveolae may be pinched off to form free vesicles within the cytoplasm.
	GO:0030054	cell junction	A cellular component that forms a specialized region of connection between two or more cells or between a cell and the extracellular matrix. At a cell junction, anchoring proteins extend through the plasma membrane to link cytoskeletal proteins in one cell to cytoskeletal proteins in neighboring cells or to proteins in the extracellular matrix.
	GO:0030864	cortical actin cytoskeleton	The portion of the actin cytoskeleton, comprising filamentous actin and associated proteins, that lies just beneath the plasma membrane.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005925	focal adhesion	Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0032587	ruffle membrane	The portion of the plasma membrane surrounding a ruffle.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2loz)

	Sites
(no "Sites" information available for 2loz)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2loz)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2loz
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	RHG07_HUMAN \| Q96QB1
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	TNS2_HUMAN \| Q63HR2
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.1.3.-
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	RHG07_HUMAN \| Q96QB1
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	TNS2_HUMAN \| Q63HR2
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	RHG07_HUMAN \| Q96QB1	:	2dky 2gyt 2kap 3kuq 5fzt
	TNS2_HUMAN \| Q63HR2	:	2dkq 2kno 2l6k 3hqc

(no "Related Entries Specified in the PDB File" available for 2LOZ)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (6, 6)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (48, 53)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File