3FEY - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF THE CBC-IMPORTIN ALPHA COMPLEX.

Authors :   S. M. G. Dias, A. L. B. Ambrosio, R. A. Cerione

Date :   01 Dec 08 (Deposition) - 11 Aug 09 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.20

Chains :   Asym./Biol. Unit : A,B,C

Keywords :   Cap Binding Complex, Importin Alpha, Nuclear Transport, Mrna Transport, Nucleus, Phosphoprotein, Rna-Binding, Host-Virus Interaction, Translation, Protein Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. M. Dias, K. F. Wilson, K. S. Rojas, A. L. Ambrosio, R. A. Cerione
The Molecular Basis For The Regulation Of The Cap-Binding Complex By The Importins.
Nat. Struct. Mol. Biol. V. 16 930 2009
PubMed-ID: 19668212 | Reference-DOI: 10.1038/NSMB.1649

Molecule 1 - NUCLEAR CAP-BINDING PROTEIN SUBUNIT 1
	Chains	:	A
	Engineered	:	YES
	Expression System	:	SPODOPTERA FRUGIPERDA
	Expression System Common	:	FALL ARMYWORM
	Expression System Plasmid	:	PVL1393
	Expression System Strain	:	SF21
	Expression System Taxid	:	562
	Expression System Vector Type	:	BACULOVIRUS
	Gene	:	CBP80, NCBP, NCBP1
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	CAP BINDING PROTEIN 80; 80 KDA NUCLEAR CAP-BINDING PROTEIN

Molecule 2 - NUCLEAR CAP-BINDING PROTEIN SUBUNIT 2
	Chains	:	B
	Engineered	:	YES
	Expression System	:	SPODOPTERA FRUGIPERDA
	Expression System Common	:	FALL ARMYWORM
	Expression System Plasmid	:	PVL1393
	Expression System Strain	:	SF21
	Expression System Taxid	:	562
	Expression System Vector Type	:	BACULOVIRUS
	Gene	:	CBP20, NCBP2, PIG55
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	CAP BINDING PROTEIN 20

Molecule 3 - IMPORTIN SUBUNIT ALPHA-2
	Chains	:	C
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET 30
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	KPNA2, RCH1, SRP1
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	IMPORTIN ALPHA 1

		1	2	3
Asymmetric/Biological Unit	:	A	B	C

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 3FEY)

(no "Site" information available for 3FEY)

(no "SS Bond" information available for 3FEY)

Asymmetric/Biological Unit

No.	Residues
1	Lys A:221	-	Pro A:222
2	Leu A:362	-	Pro A:363
3	Ser C:219	-	Ser C:220
4	Asn C:241	-	Pro C:242

Asymmetric/Biological Unit (5, 5)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_067625	A	157	V	IMA1_HUMAN	Polymorphism	17850032	C	A	157	V
2	UniProt	VAR_013137	P	165	R	IMA1_HUMAN	Polymorphism	11545989	C	P	165	R
3	UniProt	VAR_067626	G	365	S	IMA1_HUMAN	Polymorphism	1059558	C	G	365	S
4	UniProt	VAR_014453	T	430	P	IMA1_HUMAN	Polymorphism	1059538	C	T	430	P
5	UniProt	VAR_067627	K	453	N	IMA1_HUMAN	Polymorphism	17850031	C	K	453	N

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric/Biological Unit (2, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	RRM	PS50102	Eukaryotic RNA Recognition Motif (RRM) profile.	NCBP2_HUMAN	40-118	1	B:40-118
2	ARM_REPEAT	PS50176	Armadillo/plakoglobin ARM repeat profile.	IMA1_HUMAN	162-190 119-162 293-335 251-293 335-377	5	C:162-190 C:119-162 C:293-335 C:251-293 C:335-377

Asymmetric/Biological Unit (34, 34)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000321256	1a	ENSE00001056985	chr3:196669468-196669297	172	NCBP2_HUMAN	1-26	26	1	B:12-15	4
1.3c	ENST00000321256	3c	ENSE00001786473	chr3:196666303-196666122	182	NCBP2_HUMAN	27-87	61	1	B:30-87 (gaps)	58
1.3g	ENST00000321256	3g	ENSE00001618834	chr3:196664519-196664381	139	NCBP2_HUMAN	87-133	47	1	B:87-126	40
1.3p	ENST00000321256	3p	ENSE00001929594	chr3:196663953-196662278	1676	NCBP2_HUMAN	134-156	23	0	-	-

2.1	ENST00000330459	1	ENSE00001673356	chr17:66031848-66031956	109	IMA1_HUMAN	-	0	0	-	-
2.2	ENST00000330459	2	ENSE00002150216	chr17:66033226-66033323	98	IMA1_HUMAN	1-25	25	0	-	-
2.3	ENST00000330459	3	ENSE00001697155	chr17:66033474-66033611	138	IMA1_HUMAN	26-71	46	1	C:69-71	3
2.4	ENST00000330459	4	ENSE00001771132	chr17:66036794-66036882	89	IMA1_HUMAN	72-101	30	1	C:72-101	30
2.5	ENST00000330459	5	ENSE00001684697	chr17:66038201-66038469	269	IMA1_HUMAN	101-191	91	1	C:101-191	91
2.6	ENST00000330459	6	ENSE00001643282	chr17:66039021-66039115	95	IMA1_HUMAN	191-222	32	1	C:191-222 (gaps)	32
2.7	ENST00000330459	7	ENSE00001723038	chr17:66039216-66039479	264	IMA1_HUMAN	223-310	88	1	C:223-310	88
2.8	ENST00000330459	8	ENSE00001716874	chr17:66039954-66040187	234	IMA1_HUMAN	311-388	78	1	C:311-388	78
2.9	ENST00000330459	9	ENSE00001712528	chr17:66040437-66040619	183	IMA1_HUMAN	389-449	61	1	C:389-449	61
2.10	ENST00000330459	10	ENSE00001781256	chr17:66041888-66042037	150	IMA1_HUMAN	450-499	50	1	C:450-499	50
2.11	ENST00000330459	11	ENSE00001735149	chr17:66042620-66042969	350	IMA1_HUMAN	500-529	30	0	-	-

3.1a	ENST00000375147	1a	ENSE00002154723	chr9:100395908-100396197	290	NCBP1_HUMAN	1-12	12	1	A:2-12	11
3.2	ENST00000375147	2	ENSE00001610908	chr9:100403076-100403164	89	NCBP1_HUMAN	12-41	30	1	A:12-41	30
3.3	ENST00000375147	3	ENSE00001626181	chr9:100403844-100403944	101	NCBP1_HUMAN	42-75	34	1	A:42-75	34
3.4	ENST00000375147	4	ENSE00001686031	chr9:100405486-100405642	157	NCBP1_HUMAN	75-127	53	1	A:75-127	53
3.5	ENST00000375147	5	ENSE00001730187	chr9:100407399-100407506	108	NCBP1_HUMAN	128-163	36	1	A:128-163	36
3.6	ENST00000375147	6	ENSE00001803534	chr9:100407893-100408014	122	NCBP1_HUMAN	164-204	41	1	A:164-204	41
3.7	ENST00000375147	7	ENSE00001693192	chr9:100409774-100409843	70	NCBP1_HUMAN	204-227	24	1	A:204-227	24
3.8	ENST00000375147	8	ENSE00001662271	chr9:100410290-100410505	216	NCBP1_HUMAN	228-299	72	1	A:228-299	72
3.9b	ENST00000375147	9b	ENSE00001610051	chr9:100412785-100412882	98	NCBP1_HUMAN	300-332	33	1	A:300-332	33
3.10	ENST00000375147	10	ENSE00001738969	chr9:100413592-100413655	64	NCBP1_HUMAN	332-353	22	1	A:332-353	22
3.11	ENST00000375147	11	ENSE00001767060	chr9:100416080-100416190	111	NCBP1_HUMAN	354-390	37	1	A:354-390	37
3.12	ENST00000375147	12	ENSE00001626418	chr9:100417162-100417226	65	NCBP1_HUMAN	391-412	22	1	A:391-412	22
3.13	ENST00000375147	13	ENSE00001803324	chr9:100417984-100418046	63	NCBP1_HUMAN	412-433	22	1	A:412-433	22
3.14	ENST00000375147	14	ENSE00001648128	chr9:100418293-100418367	75	NCBP1_HUMAN	433-458	26	1	A:433-458	26
3.15	ENST00000375147	15	ENSE00001763342	chr9:100420922-100421025	104	NCBP1_HUMAN	458-493	36	1	A:458-493	36
3.16	ENST00000375147	16	ENSE00001592843	chr9:100423228-100423350	123	NCBP1_HUMAN	493-534	42	1	A:493-525	33
3.17	ENST00000375147	17	ENSE00001800577	chr9:100424324-100424426	103	NCBP1_HUMAN	534-568	35	1	A:539-568	30
3.18	ENST00000375147	18	ENSE00001802313	chr9:100425236-100425329	94	NCBP1_HUMAN	568-599	32	1	A:568-599	32
3.19	ENST00000375147	19	ENSE00001714911	chr9:100426622-100426725	104	NCBP1_HUMAN	600-634	35	1	A:600-634	35
3.20b	ENST00000375147	20b	ENSE00001728703	chr9:100429045-100429159	115	NCBP1_HUMAN	634-672	39	1	A:634-667	34
3.21	ENST00000375147	21	ENSE00000926499	chr9:100431128-100431256	129	NCBP1_HUMAN	673-715	43	1	A:683-715	33
3.22a	ENST00000375147	22a	ENSE00000926500	chr9:100431875-100431988	114	NCBP1_HUMAN	716-753	38	1	A:716-753	38
3.23a	ENST00000375147	23a	ENSE00001465914	chr9:100433368-100436030	2663	NCBP1_HUMAN	754-790	37	1	A:754-790	37

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:761
 aligned with NCBP1_HUMAN | Q09161 from UniProtKB/Swiss-Prot  Length:790

    Alignment length:789
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721       731       741       751       761       771       781         
          NCBP1_HUMAN     2 SRRRHSDENDGGQPHKRRKTSDANETEDHLESLICKVGEKSACSLESNLEGLAGVLEADLPNYKSKILRLLCTVARLLPEKLTIYTTLVGLLNARNYNFGGEFVEAMIRQLKESLKANNYNEAVYLVRFLSDLVNCHVIAAPSMVAMFENFVSVTQEEDVPQVRRDWYVYAFLSSLPWVGKELYEKKDAEMDRIFANTESYLKRRQKTHVPMLQVWTADKPHPQEEYLDCLWAQIQKLKKDRWQERHILRPYLAFDSILCEALQHNLPPFTPPPHTEDSVYPMPRVIFRMFDYTDDPEGPVMPGSHSVERFVIEENLHCIIKSHWKERKTCAAQLVSYPGKNKIPLNYHIVEVIFAELFQLPAPPHIDVMYTTLLIELCKLQPGSLPQVLAQATEMLYMRLDTMNTTCVDRFINWFSHHLSNFQFRWSWEDWSDCLSQDPESPKPKFVREVLEKCMRLSYHQRILDIVPPTFSALCPANPTCIYKYGDESSNSLPGHSVALCLAVAFKSKATNDEIFSILKDVPNPNQDDDDDEGFSFNPLKIEVFVQTLLHLAAKSFSHSFSALAKFHEVFKTLAESDEGKLHVLRVMFEVWRNHPQMIAVLVDKMIRTQIVDCAAVANWIFSSELSRDFTRLFVWEILHSTIRKMNKHVLKIQKELEEAKEKLARQHKRRSDDDDRSSDRKDGVLEEQIERLQEKVESAQSEQKNLFLVIFQRFIMILTEHLVRCETDGTSVLTPWYKNCIERLQQIFLQHHQIIQQYMVTLENLLFTAELDPHILAVFQQFCALQA 790
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3feyA01 A:2-289  [code=1.25.40.180, no name defined]                                                                                                                                                                                                                                            3feyA02 A:290-481  [code=1.25.40.180, no name defined]                                                                                                                                          3feyA03 A:482-790  [code=1.25.40.180, no nam             e defined]                                                                                                                                                                                                                                                   CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....................hhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhh...........hhhhhhhhhhhhhhhh........hhhhhhhhhhhhh.............................hhhhh..........hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhh.......hhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhh...hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh...................hhhhhhhhhhhhhh..hhhhhhhhhh...-------------.hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.---------------hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhh.....hhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 3 (1) Exon 3.1a  -----------------------------Exon 3.3  PDB: A:42-75            ----------------------------------------------------Exon 3.5  PDB: A:128-163            Exon 3.6  PDB: A:164-204 UniProt: 164-204-----------------------Exon 3.8  PDB: A:228-299 UniProt: 228-299                               --------------------------------Exon 3.10             Exon 3.11  PDB: A:354-390            Exon 3.12             --------------------Exon 3.14  PDB: A:433-458 ----------------------------------Exon 3.16  PDB: A:493-525 UniProt: 493-534---------------------------------Exon 3.18  PDB: A:568-599       Exon 3.19  PDB: A:600-634          --------------------------------------Exon 3.21  PDB: A:683-715 UniProt: 673-715 Exon 3.22a  PDB: A:716-753            Exon 3.23a  PDB: A:754-790            Transcript 3 (1)
           Transcript 3 (2) ----------Exon 3.2  PDB: A:12-41        ---------------------------------Exon 3.4  PDB: A:75-127 UniProt: 75-127              ----------------------------------------------------------------------------Exon 3.7  PDB: A:204-227------------------------------------------------------------------------Exon 3.9b  PDB: A:300-332        -------------------------------------------------------------------------------Exon 3.13             ------------------------Exon 3.15  PDB: A:458-493           ----------------------------------------Exon 3.17  PDB: A:539-568          -----------------------------------------------------------------Exon 3.20b  PDB: A:634-667 [INCOMPLETE]---------------------------------------------------------------------------------------------------------------------- Transcript 3 (2)
                 3fey A   2 SRRRHSDENDGGQPHKRRKTSDANETEDHLESLICKVGEKSACSLESNLEGLAGVLEADLPNYKSKILRLLCTVARLLPEKLTIYTTLVGLLNARNYNFGGEFVEAMIRQLKESLKANNYNEAVYLVRFLSDLVNCHVIAAPSMVAMFENFVSVTQEEDVPQVRRDWYVYAFLSSLPWVGKELYEKKDAEMDRIFANTESYLKRRQKTHVPMLQVWTADKPHPQEEYLDCLWAQIQKLKKDRWQERHILRPYLAFDSILCEALQHNLPPFTPPPHTEDSVYPMPRVIFRMFDYTDDPEGPVMPGSHSVERFVIEENLHCIIKSHWKERKTCAAQLVSYPGKNKIPLNYHIVEVIFAELFQLPAPPHIDVMYTTLLIELCKLQPGSLPQVLAQATEMLYMRLDTMNTTCVDRFINWFSHHLSNFQFRWSWEDWSDCLSQDPESPKPKFVREVLEKCMRLSYHQRILDIVPPTFSALCPANPTCIYKYGDESSNSLPGHSVALCLAVAFKSKATNDEIFSILKDVP-------------FNPLKIEVFVQTLLHLAAKSFSHSFSALAKFHEVFKTLAESDEGKLHVLRVMFEVWRNHPQMIAVLVDKMIRTQIVDCAAVANWIFSSELSRDFTRLFVWEILHSTIRKMNKHVLKIQKELEEAKEKLA---------------RKDGVLEEQIERLQEKVESAQSEQKNLFLVIFQRFIMILTEHLVRCETDGTSVLTPWYKNCIERLQQIFLQHHQIIQQYMVTLENLLFTAELDPHILAVFQQFCALQA 790
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521   |     -       541       551       561       571       581       591       601       611       621       631       641       651       661     |   -         - |     691       701       711       721       731       741       751       761       771       781         
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     525           539                                                                                                                             667             683

Chain B from PDB  Type:PROTEIN  Length:97
 aligned with NCBP2_HUMAN | P52298 from UniProtKB/Swiss-Prot  Length:156

    Alignment length:115
                                    21        31        41        51        61        71        81        91       101       111       121     
          NCBP2_HUMAN    12 DSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAGFKEGRQYG 126
               SCOP domains d3fe              yb_ B: CBP20, 20KDa nuclear cap-binding prote    in                                               SCOP domains
               CATH domains 3fey              B00 B:12-126  [code=3.30.70.330, no name defi    ned]                                             CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....--------------hhhhhhhhhh.eeeee......hhhhhhhhhhhhh.eeeeee...----.....eeeee.hhhhhhhhhhhh...ee..ee.eeeee.......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------RRM  PDB: B:40-118 UniProt: 40-118                                             -------- PROSITE
           Transcript 1 (1) Exon 1.1a      Exon 1.3c  PDB: B:30-87 (gaps) UniProt: 27-87 [INCOMPLETE]   --------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------------------Exon 1.3g  PDB: B:87-126 UniProt: 87-133 Transcript 1 (2)
                 3fey B  12 DSYV--------------EEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLD----TACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAGFKEGRQYG 126
                               |     -        31        41        51        61        71  |    |81        91       101       111       121     
                              15             30                                          74   79

Chain C from PDB  Type:PROTEIN  Length:428
 aligned with IMA1_HUMAN | P52292 from UniProtKB/Swiss-Prot  Length:529

    Alignment length:431
                                    78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       478       488       498 
           IMA1_HUMAN    69 NNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSVE 499
               SCOP domains d3feyc_ C: automated matches                                                                                                                                                                                                                                                                                                                                                                                                                    SCOP domains
               CATH domains 3feyC00 C:69-499 Leucine-rich Repeat Variant                                                                                                                                                                                                                                                                                                                                                                                                    CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhhh..hhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh.hhhhhhhhhhh.hhhhhhhh...---...hhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh.hhhhhhhhhhh.hhhhhhhhh...hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh..hhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------V-------R-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------S----------------------------------------------------------------P----------------------N---------------------------------------------- SAPs(SNPs)
                PROSITE (1) ---------------------------------------------------------------------------------------------ARM_REPEAT  PDB: C:162-190   ------------------------------------------------------------------------------------------------------ARM_REPEAT  PDB: C:293-335 UniProt: 293-335-------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (1)
                PROSITE (2) --------------------------------------------------ARM_REPEAT  PDB: C:119-162 UniProt: 119-162 ----------------------------------------------------------------------------------------ARM_REPEAT  PDB: C:251-293 UniProt: 251-293-----------------------------------------ARM_REPEAT  PDB: C:335-377 UniProt: 335-377-------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 2 (1) 2.3Exon 2.4  PDB: C:72-101       -----------------------------------------------------------------------------------------Exon 2.6  PDB: C:191-222 (gaps) Exon 2.7  PDB: C:223-310 UniProt: 223-310                                               Exon 2.8  PDB: C:311-388 UniProt: 311-388                                     Exon 2.9  PDB: C:389-449 UniProt: 389-449                    Exon 2.10  PDB: C:450-499 UniProt: 450-499         Transcript 2 (1)
           Transcript 2 (2) --------------------------------Exon 2.5  PDB: C:101-191 UniProt: 101-191                                                  -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2 (2)
                 3fey C  69 MNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAV---SSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSVE 499
                                    78        88        98       108       118       128       138       148       158       168       178       188       198       208      |  -|      228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       478       488       498 
                                                                                                                                                                            215 219

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: alpha-alpha superhelix (690)

Superfamily: ARM repeat (317)

Family: automated matches (39)

Protein domain: automated matches (39)

Human (Homo sapiens) [TaxId: 9606] (21)

d3feyc_

Class: Alpha and beta proteins (a+b) (23004)

Fold: Ferredoxin-like (1795)

Superfamily: RNA-binding domain, RBD (289)

Family: Canonical RBD (214)

Protein domain: CBP20, 20KDa nuclear cap-binding protein (7)

Human (Homo sapiens) [TaxId: 9606] (7)

d3feyb_

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: Alpha-Beta Plaits (1688)

Homologous Superfamily: [code=3.30.70.330, no name defined] (307)

Human (Homo sapiens) (81)

3feyB00

B:12-126

Class: Mainly Alpha (13335)

Architecture: Alpha Horseshoe (399)

Topology: Leucine-rich Repeat Variant (77)

Homologous Superfamily: Leucine-rich Repeat Variant (75)

Human (Homo sapiens) (30)

3feyC00

C:69-499

Topology: Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat (320)

Homologous Superfamily: [code=1.25.40.180, no name defined] (12)

Human (Homo sapiens) (10)

3a	3feyA03	A:482-790
3b	3feyA02	A:290-481
3c	3feyA01	A:2-289

(no "Pfam Domain" information available for 3FEY)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (NCBP1_HUMAN | Q09161)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0000339	RNA cap binding	Interacting selectively and non-covalently with a 7-methylguanosine (m7G) group or derivative located at the 5' end of an RNA molecule.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0006370	7-methylguanosine mRNA capping	Addition of the 7-methylguanosine cap to the 5' end of a nascent messenger RNA transcript.
	GO:0006405	RNA export from nucleus	The directed movement of RNA from the nucleus to the cytoplasm.
	GO:0016070	RNA metabolic process	The cellular chemical reactions and pathways involving RNA, ribonucleic acid, one of the two main type of nucleic acid, consisting of a long, unbranched macromolecule formed from ribonucleotides joined in 3',5'-phosphodiester linkage.
	GO:0008380	RNA splicing	The process of removing sections of the primary RNA transcript to remove sequences not present in the mature form of the RNA and joining the remaining sections to form the mature form of the RNA.
	GO:0008543	fibroblast growth factor receptor signaling pathway	The series of molecular signals generated as a consequence of a fibroblast growth factor receptor binding to one of its physiological ligands.
	GO:0010467	gene expression	The process in which a gene's sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
	GO:0031047	gene silencing by RNA	Any process in which RNA molecules inactivate expression of target genes.
	GO:0008334	histone mRNA metabolic process	The chemical reactions and pathways involving an mRNA encoding a histone.
	GO:0031124	mRNA 3'-end processing	Any process involved in forming the mature 3' end of an mRNA molecule.
	GO:0045292	mRNA cis splicing, via spliceosome	The joining together, after removal of an intervening sequence composed of one or more introns, of two segments of the same RNA molecule via spliceosomal catalysis to produce an mRNA composed only of exon sequences that all came from the same primary transcript.
	GO:0006406	mRNA export from nucleus	The directed movement of mRNA from the nucleus to the cytoplasm.
	GO:0006397	mRNA processing	Any process involved in the conversion of a primary mRNA transcript into one or more mature mRNA(s) prior to translation into polypeptide.
	GO:0000398	mRNA splicing, via spliceosome	The joining together of exons from one or more primary transcripts of messenger RNA (mRNA) and the excision of intron sequences, via a spliceosomal mechanism, so that mRNA consisting only of the joined exons is produced.
	GO:0051028	mRNA transport	The directed movement of mRNA, messenger ribonucleic acid, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0051168	nuclear export	The directed movement of substances out of the nucleus.
	GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	The nonsense-mediated decay pathway for nuclear-transcribed mRNAs degrades mRNAs in which an amino-acid codon has changed to a nonsense codon; this prevents the translation of such mRNAs into truncated, and potentially harmful, proteins.
	GO:0030307	positive regulation of cell growth	Any process that activates or increases the frequency, rate, extent or direction of cell growth.
	GO:0031442	positive regulation of mRNA 3'-end processing	Any process that activates or increases the frequency, rate or extent of mRNA 3'-end processing.
	GO:0098789	pre-mRNA cleavage required for polyadenylation	The targeted, endonucleolytic cleavage of a pre-mRNA, required for polyadenylation of the 3' end. This cleavage is directed by binding sites near the 3' end of the mRNA and leaves a 3' hydoxyl end which then becomes a target for adenylation.
	GO:1900363	regulation of mRNA polyadenylation	Any process that modulates the frequency, rate or extent of mRNA polyadenylation.
	GO:0006417	regulation of translation	Any process that modulates the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of proteins by the translation of mRNA or circRNA.
	GO:0006446	regulation of translational initiation	Any process that modulates the frequency, rate or extent of translational initiation.
	GO:0042795	snRNA transcription from RNA polymerase II promoter	The synthesis of small nuclear RNA (snRNA) from a DNA template by RNA Polymerase II (Pol II), originating at a Pol II promoter.
	GO:0006369	termination of RNA polymerase II transcription	The process in which the synthesis of an RNA molecule by RNA polymerase II using a DNA template is completed.
	GO:0006368	transcription elongation from RNA polymerase II promoter	The extension of an RNA molecule after transcription initiation and promoter clearance at an RNA polymerase II promoter by the addition of ribonucleotides catalyzed by RNA polymerase II.
	GO:0006366	transcription from RNA polymerase II promoter	The synthesis of RNA from a DNA template by RNA polymerase II, originating at an RNA polymerase II promoter. Includes transcription of messenger RNA (mRNA) and certain small nuclear RNAs (snRNAs).
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0034518	RNA cap binding complex	Any protein complex that binds to a specialized RNA cap structure at any time in the lifetime of the RNA.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005845	mRNA cap binding complex	Any protein complex that binds to an mRNA cap at any time in the lifetime of the mRNA.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0005846	nuclear cap binding complex	A conserved heterodimeric protein complex that binds to the 5' terminal cap structure m7G(5')ppp(5')N of nascent eukaryotic RNA polymerase II transcripts such as pre-mRNA and U snRNA. The consists of proteins known as CBP20 and CBP80, binds to cap structures in the nucleus, and is involved in pre-mRNA splicing, 3'-end formation, and RNA nuclear export.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain B (NCBP2_HUMAN | P52298)

molecular function
	GO:0000340	RNA 7-methylguanosine cap binding	Interacting selectively and non-covalently with the 7-methylguanosine group added cotranscriptionally to the 5' end of RNA molecules transcribed by polymerase II.
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0000339	RNA cap binding	Interacting selectively and non-covalently with a 7-methylguanosine (m7G) group or derivative located at the 5' end of an RNA molecule.
	GO:0003729	mRNA binding	Interacting selectively and non-covalently with messenger RNA (mRNA), an intermediate molecule between DNA and protein. mRNA includes UTR and coding sequences, but does not contain introns.
	GO:0003676	nucleic acid binding	Interacting selectively and non-covalently with any nucleic acid.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0017069	snRNA binding	Interacting selectively and non-covalently with a small nuclear RNA (snRNA).
biological process
	GO:0006370	7-methylguanosine mRNA capping	Addition of the 7-methylguanosine cap to the 5' end of a nascent messenger RNA transcript.
	GO:0006405	RNA export from nucleus	The directed movement of RNA from the nucleus to the cytoplasm.
	GO:0008380	RNA splicing	The process of removing sections of the primary RNA transcript to remove sequences not present in the mature form of the RNA and joining the remaining sections to form the mature form of the RNA.
	GO:0008543	fibroblast growth factor receptor signaling pathway	The series of molecular signals generated as a consequence of a fibroblast growth factor receptor binding to one of its physiological ligands.
	GO:0010467	gene expression	The process in which a gene's sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
	GO:0031047	gene silencing by RNA	Any process in which RNA molecules inactivate expression of target genes.
	GO:0008334	histone mRNA metabolic process	The chemical reactions and pathways involving an mRNA encoding a histone.
	GO:0031124	mRNA 3'-end processing	Any process involved in forming the mature 3' end of an mRNA molecule.
	GO:0045292	mRNA cis splicing, via spliceosome	The joining together, after removal of an intervening sequence composed of one or more introns, of two segments of the same RNA molecule via spliceosomal catalysis to produce an mRNA composed only of exon sequences that all came from the same primary transcript.
	GO:0006406	mRNA export from nucleus	The directed movement of mRNA from the nucleus to the cytoplasm.
	GO:0006397	mRNA processing	Any process involved in the conversion of a primary mRNA transcript into one or more mature mRNA(s) prior to translation into polypeptide.
	GO:0000398	mRNA splicing, via spliceosome	The joining together of exons from one or more primary transcripts of messenger RNA (mRNA) and the excision of intron sequences, via a spliceosomal mechanism, so that mRNA consisting only of the joined exons is produced.
	GO:0051028	mRNA transport	The directed movement of mRNA, messenger ribonucleic acid, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0051168	nuclear export	The directed movement of substances out of the nucleus.
	GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	The nonsense-mediated decay pathway for nuclear-transcribed mRNAs degrades mRNAs in which an amino-acid codon has changed to a nonsense codon; this prevents the translation of such mRNAs into truncated, and potentially harmful, proteins.
	GO:0046833	positive regulation of RNA export from nucleus	Any process that activates or increases the frequency, rate or extent of directed movement of RNA from the nucleus into the cytoplasm.
	GO:0031442	positive regulation of mRNA 3'-end processing	Any process that activates or increases the frequency, rate or extent of mRNA 3'-end processing.
	GO:0098789	pre-mRNA cleavage required for polyadenylation	The targeted, endonucleolytic cleavage of a pre-mRNA, required for polyadenylation of the 3' end. This cleavage is directed by binding sites near the 3' end of the mRNA and leaves a 3' hydoxyl end which then becomes a target for adenylation.
	GO:1900363	regulation of mRNA polyadenylation	Any process that modulates the frequency, rate or extent of mRNA polyadenylation.
	GO:0006417	regulation of translation	Any process that modulates the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of proteins by the translation of mRNA or circRNA.
	GO:0006446	regulation of translational initiation	Any process that modulates the frequency, rate or extent of translational initiation.
	GO:0006408	snRNA export from nucleus	The directed movement of snRNA from the nucleus to the cytoplasm.
	GO:0042795	snRNA transcription from RNA polymerase II promoter	The synthesis of small nuclear RNA (snRNA) from a DNA template by RNA Polymerase II (Pol II), originating at a Pol II promoter.
	GO:0006369	termination of RNA polymerase II transcription	The process in which the synthesis of an RNA molecule by RNA polymerase II using a DNA template is completed.
	GO:0006368	transcription elongation from RNA polymerase II promoter	The extension of an RNA molecule after transcription initiation and promoter clearance at an RNA polymerase II promoter by the addition of ribonucleotides catalyzed by RNA polymerase II.
	GO:0006366	transcription from RNA polymerase II promoter	The synthesis of RNA from a DNA template by RNA polymerase II, originating at an RNA polymerase II promoter. Includes transcription of messenger RNA (mRNA) and certain small nuclear RNAs (snRNAs).
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005845	mRNA cap binding complex	Any protein complex that binds to an mRNA cap at any time in the lifetime of the mRNA.
	GO:0005846	nuclear cap binding complex	A conserved heterodimeric protein complex that binds to the 5' terminal cap structure m7G(5')ppp(5')N of nascent eukaryotic RNA polymerase II transcripts such as pre-mRNA and U snRNA. The consists of proteins known as CBP20 and CBP80, binds to cap structures in the nucleus, and is involved in pre-mRNA splicing, 3'-end formation, and RNA nuclear export.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain C (IMA1_HUMAN | P52292)

molecular function
	GO:0042826	histone deacetylase binding	Interacting selectively and non-covalently with the enzyme histone deacetylase.
	GO:0008139	nuclear localization sequence binding	Interacting selectively and non-covalently with a nuclear localization sequence, a specific peptide sequence that acts as a signal to localize the protein within the nucleus.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0008565	protein transporter activity	Enables the directed movement of proteins into, out of or within a cell, or between cells.
biological process
	GO:0006259	DNA metabolic process	Any cellular metabolic process involving deoxyribonucleic acid. This is one of the two main types of nucleic acid, consisting of a long, unbranched macromolecule formed from one, or more commonly, two, strands of linked deoxyribonucleotides.
	GO:0006607	NLS-bearing protein import into nucleus	The directed movement of a protein bearing a nuclear localization signal (NLS) from the cytoplasm into the nucleus, across the nuclear membrane.
	GO:0075733	intracellular transport of virus	The directed movement of a virus, or part of a virus, within the host cell.
	GO:0019054	modulation by virus of host process	The process in which a virus effects a change in the processes and activities of its host organism.
	GO:0006606	protein import into nucleus	The directed movement of a protein from the cytoplasm to the nucleus.
	GO:0015031	protein transport	The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0000018	regulation of DNA recombination	Any process that modulates the frequency, rate or extent of DNA recombination, a DNA metabolic process in which a new genotype is formed by reassortment of genes resulting in gene combinations different from those that were present in the parents.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005643	nuclear pore	Any of the numerous similar discrete openings in the nuclear envelope of a eukaryotic cell, where the inner and outer nuclear membranes are joined.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3fey)

	Sites
(no "Sites" information available for 3fey)

	Cis Peptide Bonds
		Asn C:241 - Pro C:242	[ RasMol ]
		Leu A:362 - Pro A:363	[ RasMol ]
		Lys A:221 - Pro A:222	[ RasMol ]
		Ser C:219 - Ser C:220	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3fey
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	IMA1_HUMAN \| P52292
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	NCBP1_HUMAN \| Q09161
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	NCBP2_HUMAN \| P52298
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	IMA1_HUMAN \| P52292
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	NCBP1_HUMAN \| Q09161
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	NCBP2_HUMAN \| P52298
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	IMA1_HUMAN \| P52292	:	1efx 1qgk 1qgr 3fex 3wpt 4e4v 4wv6
	NCBP1_HUMAN \| Q09161	:	1h2t 1h2u 1h2v 1h6k 1n52 1n54 3fex
	NCBP2_HUMAN \| P52298	:	1h2t 1h2u 1h2v 1h6k 1n52 1n54 3fex

3fex	LOWER RESOLUTION STRUCTURE

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (5, 5)

PROSITE Motifs (2, 6)

Exons (34, 34)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 2)

CATH Domains (3, 5)

Pfam Domains (0, 0)

Gene Ontology (59, 99)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File