Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  E. COLI QUINOL FUMARATE REDUCTASE FRDA T234A MUTATION
 
Authors :  T. M. Tomasiak, E. Maklashina, G. Cecchini, T. M. Iverson
Date :  11 Mar 08  (Deposition) - 01 Apr 08  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.65
Chains :  Asym. Unit :  A,B,C,D,M,N,O,P
Biol. Unit 1:  A,B,C,D  (1x)
Biol. Unit 2:  M,N,O,P  (1x)
Keywords :  Electron Transport, Tricarboxylic Acid Cycle, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  T. M. Tomasiak, E. Maklashina, G. Cecchini, T. M. Iverson
A Threonine On The Active Site Loop Controls Transition State Formation In Escherichia Coli Respiratory Complex Ii.
J. Biol. Chem. V. 283 15460 2008
PubMed-ID: 18385138  |  Reference-DOI: 10.1074/JBC.M801372200
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT
    Chains: A, M
    EC Number: 1.3.99.1
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PH3
    Expression System Strain: DW35
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: FRDA
    Mutation: YES
    Organism Scientific: ESCHERICHIA COLI
    Organism Taxid: 562
 
Molecule 2 - FUMARATE REDUCTASE IRON-SULFUR SUBUNIT
    Chains: B, N
    EC Number: 1.3.99.1
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PH3
    Expression System Strain: DW35
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: FRDB
    Organism Scientific: ESCHERICHIA COLI
    Organism Taxid: 562
 
Molecule 3 - FUMARATE REDUCTASE SUBUNIT C
    Chains: C, O
    EC Number: 1.3.99.1
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PH3
    Expression System Strain: DW35
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: FRDC
    Organism Scientific: ESCHERICHIA COLI
    Organism Taxid: 562
 
Molecule 4 - FUMARATE REDUCTASE SUBUNIT D
    Chains: D, P
    EC Number: 1.3.99.1
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PH3
    Expression System Strain: DW35
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: FRDD
    Organism Scientific: ESCHERICHIA COLI
    Organism Taxid: 562

 Structural Features

(-) Chains, Units

  12345678
Asymmetric Unit : ABCDMNOP
Biological Unit 1 (1x): ABCD    
Biological Unit 2 (1x):     MNOP

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 8)

Asymmetric Unit (4, 8)
No.NameCountTypeFull Name
1F3S2Ligand/IonFE3-S4 CLUSTER
2FAD2Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE
3FES2Ligand/IonFE2/S2 (INORGANIC) CLUSTER
4SF42Ligand/IonIRON/SULFUR CLUSTER
Biological Unit 1 (4, 4)
No.NameCountTypeFull Name
1F3S1Ligand/IonFE3-S4 CLUSTER
2FAD1Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE
3FES1Ligand/IonFE2/S2 (INORGANIC) CLUSTER
4SF41Ligand/IonIRON/SULFUR CLUSTER
Biological Unit 2 (4, 4)
No.NameCountTypeFull Name
1F3S1Ligand/IonFE3-S4 CLUSTER
2FAD1Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE
3FES1Ligand/IonFE2/S2 (INORGANIC) CLUSTER
4SF41Ligand/IonIRON/SULFUR CLUSTER

(-) Sites  (8, 8)

Asymmetric Unit (8, 8)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELEU B:37 , CYS B:57 , ARG B:58 , ALA B:60 , ILE B:61 , CYS B:62 , GLY B:63 , CYS B:65 , CYS B:77BINDING SITE FOR RESIDUE FES B 244
2AC2SOFTWARECYS B:158 , GLN B:160 , CYS B:204 , PHE B:206 , VAL B:207 , GLY B:208 , TYR B:209 , CYS B:210BINDING SITE FOR RESIDUE F3S B 245
3AC3SOFTWARECYS B:148 , ILE B:149 , CYS B:151 , GLY B:152 , CYS B:154 , CYS B:214 , PRO B:215BINDING SITE FOR RESIDUE SF4 B 246
4AC4SOFTWAREVAL A:10 , GLY A:11 , ALA A:12 , GLY A:14 , ALA A:15 , SER A:36 , LYS A:37 , VAL A:38 , SER A:43 , HIS A:44 , THR A:45 , ALA A:48 , GLU A:49 , GLY A:50 , GLY A:51 , HIS A:155 , PHE A:156 , VAL A:157 , ALA A:191 , THR A:192 , GLY A:193 , THR A:203 , ASN A:204 , ASP A:211 , MET A:215 , LEU A:242 , HIS A:355 , TYR A:356 , GLY A:378 , GLU A:379 , ARG A:390 , SER A:393 , ASN A:394 , SER A:395 , LEU A:396 , LEU A:399BINDING SITE FOR RESIDUE FAD A 601
5AC5SOFTWARESER N:56 , CYS N:57 , ARG N:58 , ALA N:60 , ILE N:61 , CYS N:62 , GLY N:63 , CYS N:65 , CYS N:77BINDING SITE FOR RESIDUE FES N 244
6AC6SOFTWARECYS N:158 , CYS N:204 , THR N:205 , PHE N:206 , VAL N:207 , GLY N:208 , TYR N:209 , CYS N:210 , ALA N:221 , ILE N:224BINDING SITE FOR RESIDUE F3S N 245
7AC7SOFTWARECYS N:148 , ASN N:150 , CYS N:151 , GLY N:152 , CYS N:154 , CYS N:214 , VAL N:218BINDING SITE FOR RESIDUE SF4 N 246
8AC8SOFTWAREGLY M:11 , ALA M:12 , GLY M:13 , GLY M:14 , ALA M:15 , SER M:36 , LYS M:37 , VAL M:38 , SER M:43 , HIS M:44 , THR M:45 , ALA M:47 , ALA M:48 , GLU M:49 , GLY M:50 , GLY M:51 , HIS M:155 , PHE M:156 , VAL M:157 , ALA M:191 , THR M:192 , GLY M:193 , THR M:203 , ASN M:204 , ASP M:211 , GLY M:378 , GLU M:379 , ARG M:390 , SER M:393 , ASN M:394 , SER M:395 , LEU M:396 , LEU M:399BINDING SITE FOR RESIDUE FAD M 601

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3CIR)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3CIR)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3CIR)

(-) PROSITE Motifs  (5, 10)

Asymmetric Unit (5, 10)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
12FE2S_FER_2PS51085 2Fe-2S ferredoxin-type iron-sulfur binding domain profile.FRDB_ECOLI16-97
 		  2B:15-96
N:15-96
2FRD_SDH_FAD_BINDINGPS00504 Fumarate reductase / succinate dehydrogenase FAD-binding site.FRDA_ECOLI43-52
 		  2A:42-51
M:42-51
32FE2S_FER_1PS00197 2Fe-2S ferredoxin-type iron-sulfur binding region signature.FRDB_ECOLI58-66
 		  2B:57-65
N:57-65
44FE4S_FER_2PS51379 4Fe-4S ferredoxin-type iron-sulfur binding domain profile.FRDB_ECOLI140-169
 		  2B:139-168
N:139-168
54FE4S_FER_1PS00198 4Fe-4S ferredoxin-type iron-sulfur binding region signature.FRDB_ECOLI149-160
 		  2B:148-159
N:148-159
Biological Unit 1 (5, 5)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
12FE2S_FER_2PS51085 2Fe-2S ferredoxin-type iron-sulfur binding domain profile.FRDB_ECOLI16-97
 		  1B:15-96
-
2FRD_SDH_FAD_BINDINGPS00504 Fumarate reductase / succinate dehydrogenase FAD-binding site.FRDA_ECOLI43-52
 		  1A:42-51
-
32FE2S_FER_1PS00197 2Fe-2S ferredoxin-type iron-sulfur binding region signature.FRDB_ECOLI58-66
 		  1B:57-65
-
44FE4S_FER_2PS51379 4Fe-4S ferredoxin-type iron-sulfur binding domain profile.FRDB_ECOLI140-169
 		  1B:139-168
-
54FE4S_FER_1PS00198 4Fe-4S ferredoxin-type iron-sulfur binding region signature.FRDB_ECOLI149-160
 		  1B:148-159
-
Biological Unit 2 (5, 5)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
12FE2S_FER_2PS51085 2Fe-2S ferredoxin-type iron-sulfur binding domain profile.FRDB_ECOLI16-97
 		  1-
N:15-96
2FRD_SDH_FAD_BINDINGPS00504 Fumarate reductase / succinate dehydrogenase FAD-binding site.FRDA_ECOLI43-52
 		  1-
M:42-51
32FE2S_FER_1PS00197 2Fe-2S ferredoxin-type iron-sulfur binding region signature.FRDB_ECOLI58-66
 		  1-
N:57-65
44FE4S_FER_2PS51379 4Fe-4S ferredoxin-type iron-sulfur binding domain profile.FRDB_ECOLI140-169
 		  1-
N:139-168
54FE4S_FER_1PS00198 4Fe-4S ferredoxin-type iron-sulfur binding region signature.FRDB_ECOLI149-160
 		  1-
N:148-159

(-) Exons   (0, 0)

(no "Exon" information available for 3CIR)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:541
 aligned with FRDA_ECOLI | P00363 from UniProtKB/Swiss-Prot  Length:602

    Alignment length:577
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       
           FRDA_ECOLI     1 MQTFQADLAIVGAGGAGLRAAIAAAQANPNAKIALISKVYPMRSHTVAAEGGSAAVAQDHDSFEYHFHDTVAGGDWLCEQDVVDYFVHHCPTEMTQLELWGCPWSRRPDGSVNVRRFGGMKIERTWFAADKTGFHMLHTLFQTSLQFPQIQRFDEHFVLDILVDDGHVRGLVAMNMMEGTLVQIRANAVVMATGGAGRVYRYNTNGGIVTGDGMGMALSHGVPLRDMEFVQYHPTGLPGSGILMTEGCRGEGGILVNKNGYRYLQDYGMGPETPLGEPKNKYMELGPRDKVSQAFWHEWRKGNTISTPRGDVVYLDLRHLGEKKLHERLPFICELAKAYVGVDPVKEPIPVRPTAHYTMGGIETDQNCETRIKGLFAVGECSSVGLHGANRLGSNSLAELVVFGRLAGEQATERAATAGNGNEAAIEAQAAGVEQRLKDLVNQDGGENWAKIRDEMGLAMEEGCGIYRTPELMQKTIDKLAELQERFKRVRITDTSSVFNTDLLYTIELGHGLNVAECMAHSAMARKESRGAHQRLDEGCTERDDVNFLKHTLAFRDADGTTRLEYSDVKITTLPPA 577
               SCOP domains d3cira2 A:0-225,A:358-442 Fumarate reductase                                                                                                                                                                                      d3cira3 A:226-357 Fumarate r                                 eductase                                                               d3cira2 A:0-225,A:358-442 Fumarate reductase                                         d3cira1 A:443-576 Fumarate reductase                                                                                                   SCOP domains
               CATH domains 3cirA01 A:0-233,A:352-421  [code=3.50.50.60, no name defined]                                                                                                                                                                             ----------------------------------------------------------------------------------------------------------------------3cirA01 A:0-233,A:352-421  [code=3.50.50.60, no name defined]         3cirA03 A:422-541  [code=1.20.58.100, no name defined]                                                                  3cirA04 A:542-576                   CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee..eeee..hhhhhhhhhhhhhhh....eeeee..hhhhhhhhhh...ee.......hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhh..............ee.........ee....hhhhhhhhhhhhhhh....eeeee.eeeeeeee....eeeeeeee....eeeeee...eee....hhhhh..........hhhhhhhhh....ee....eeee............hhhhhh...---------------------------------hhhhhhhhhh.............---...hhhhhhhhhhhhhhhhhhhhhhhhh............eeeee..eee...........eee....ee..........hhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhh.......................eeeeeee.....eeeeeee......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ------------------------------------------FRD_SDH_FA--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3cir A   0 MQTFQADLAIVGAGGAGLRAAIAAAQANPNAKIALISKVYPMRSHTVAAEGGSAAVAQDHDSFEYHFHDTVAGGDWLCEQDVVDYFVHHCPTEMTQLELWGCPWSRRPDGSVNVRRFGGMKIERTWFAADKTGFHMLHTLFQTSLQFPQIQRFDEHFVLDILVDDGHVRGLVAMNMMEGTLVQIRANAVVMATGGAGRVYRYNTNGGIVTGDGMGMALSHGVPLRDMEFVQYHPAGLPGSGILMTEGCRGEGGI---------------------------------RDKVSQAFWHEWRKGNTISTPRG---YLDLRHLGEKKLHERLPFICELAKAYVGVDPVKEPIPVRPTAHYTMGGIETDQNCETRIKGLFAVGECSSVGLHGANRLGSNSLAELVVFGRLAGEQATERAATAGNGNEAAIEAQAAGVEQRLKDLVNQDGGENWAKIRDEMGLAMEEGCGIYRTPELMQKTIDKLAELQERFKRVRITDTSSVFNTDLLYTIELGHGLNVAECMAHSAMARKESRGAHQRLDEGCTERDDVNFLKHTLAFRDADGTTRLEYSDVKITTLPPA 576
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249   |     -         -         -       289       299       309   |   319       329       339       349       359       369       379       389       399       409       419       429       439       449       459       469       479       489       499       509       519       529       539       549       559       569       
                                                                                                                                                                                                                                                                                       253                               287                   309 313                                                                                                                                                                                                                                                                       


Chain B from PDB  Type:PROTEIN  Length:243
 aligned with FRDB_ECOLI | P0AC47 from UniProtKB/Swiss-Prot  Length:244

    Alignment length:243
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241   
           FRDB_ECOLI     2 AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR 244
               SCOP domains d3cirb2 B:1-105 Fumarate reductase iron-sulfur protein, N-terminal domain                                d3cirb1 B:106-243 Fumarate reductase                                                                                                       SCOP domains
               CATH domains -3cirB01 B:2-105  [code=3.10.20.30, no name defined]                                                     3cirB02 B:106-243 Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2                                                                CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeeee.........eeeeeeeee....hhhhhhhhhhhhh..................eeee..eeee.hhhhhhhh....eee......eee..ee.hhhhhhhhhhh.........hhhhh....hhhhhhhhhhhhhh...hhhhhhhhhhhhh....hhhhhhhhhhhhhh.....hhhhhhhhh...hhhhh....hhhhhh....hhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --------------2FE2S_FER_2  PDB: B:15-96 UniProt: 16-97                                          ------------------------------------------4FE4S_FER_2  PDB: B:139-168   --------------------------------------------------------------------------- PROSITE (1)
                PROSITE (2) --------------------------------------------------------2FE2S_FER----------------------------------------------------------------------------------4FE4S_FER_1 ------------------------------------------------------------------------------------ PROSITE (2)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3cir B   1 AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR 243
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240   


Chain C from PDB  Type:PROTEIN  Length:130
 aligned with FRDC_ECOLI | P0A8Q0 from UniProtKB/Swiss-Prot  Length:131

    Alignment length:130
                                    11        21        31        41        51        61        71        81        91       101       111       121       131
           FRDC_ECOLI     2 TTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKNGPEAWAGFVDFLQNPVIVIINLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKSLWAVTVVATIVILFVALYW 131
               SCOP domains d3circ1 C:1-130 Fumarate reductase subunit FrdC                                                                                    SCOP domains
               CATH domains 3cirC00 C:1-130 Fumarate reductase respiratory complex transmembrane subunits                                                      CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............hhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3cir C   1 TTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKNGPEAWAGFVDFLQNPVIVIINLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKSLWAVTVVATIVILFVALYW 130
                                    10        20        30        40        50        60        70        80        90       100       110       120       130


Chain D from PDB  Type:PROTEIN  Length:119
 aligned with FRDD_ECOLI | P0A8Q3 from UniProtKB/Swiss-Prot  Length:119

    Alignment length:119
                                    10        20        30        40        50        60        70        80        90       100       110         
           FRDD_ECOLI     1 MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQSFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGVVTI 119
               SCOP domains d3cird1 D:0-118 Fumarate reductase subunit FrdD                                                                         SCOP domains
               CATH domains 3cirD00 D:0-118 Fumarate reductase respiratory complex transmembrane subunits                                           CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript
                 3cir D   0 MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQSFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGVVTI 118
                                     9        19        29        39        49        59        69        79        89        99       109         


Chain M from PDB  Type:PROTEIN  Length:504
 aligned with FRDA_ECOLI | P00363 from UniProtKB/Swiss-Prot  Length:602

    Alignment length:572
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570  
           FRDA_ECOLI     1 MQTFQADLAIVGAGGAGLRAAIAAAQANPNAKIALISKVYPMRSHTVAAEGGSAAVAQDHDSFEYHFHDTVAGGDWLCEQDVVDYFVHHCPTEMTQLELWGCPWSRRPDGSVNVRRFGGMKIERTWFAADKTGFHMLHTLFQTSLQFPQIQRFDEHFVLDILVDDGHVRGLVAMNMMEGTLVQIRANAVVMATGGAGRVYRYNTNGGIVTGDGMGMALSHGVPLRDMEFVQYHPTGLPGSGILMTEGCRGEGGILVNKNGYRYLQDYGMGPETPLGEPKNKYMELGPRDKVSQAFWHEWRKGNTISTPRGDVVYLDLRHLGEKKLHERLPFICELAKAYVGVDPVKEPIPVRPTAHYTMGGIETDQNCETRIKGLFAVGECSSVGLHGANRLGSNSLAELVVFGRLAGEQATERAATAGNGNEAAIEAQAAGVEQRLKDLVNQDGGENWAKIRDEMGLAMEEGCGIYRTPELMQKTIDKLAELQERFKRVRITDTSSVFNTDLLYTIELGHGLNVAECMAHSAMARKESRGAHQRLDEGCTERDDVNFLKHTLAFRDADGTTRLEYSDVKIT 572
               SCOP domains d3cirm2 M:0-225,M:358-442 Fumarate reductase                                                                                                                                                                                      d3cirm3 M:226-357 Fuma                                       rate reductase                                                         d3cirm2 M:0-225,M:358-442 Fumarate reductase                                         d3cirm1 M:443-571 Fumarate reductase                                                                                              SCOP domains
               CATH domains 3cirM01 M:0-233,M:352-421  [code=3.50.50.60, no name defined]                                                                                                                                                                             ----------------------------------------------------------------------------------------------------------------------3cirM01 M:0-233,M:352-421  [code=3.50.50.60, no name defined]         3cirM03 M:422-541  [code=1.20.58.100, no name defined]                                                                  3cirM04 M:542-571              CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee..eeee..hhhhhhhhhhhhh......eeee...hhhhhhhhhh...ee.......hhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhh.............ee.........ee....hhhhhhhhhhhhhhhhh..eeee..eeeeeeeee..eeeeeeeee.....eeeee...eee....hhhhh..........hhhhhhhh...........eeee...............---------------------------------------.....hhhhhhhhh.....----------------.....---.hhhhhhhh----------....eeeee................eee.................hhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhhhhhhhhh..........................eeee.....eeee....... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ------------------------------------------FRD_SDH_FA---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3cir M   0 MQTFQADLAIVGAGGAGLRAAIAAAQANPNAKIALISKVYPMRSHTVAAEGGSAAVAQDHDSFEYHFHDTVAGGDWLCEQDVVDYFVHHCPTEMTQLELWGCPWSRRPDGSVNVRRFGGMKIERTWFAADKTGFHMLHTLFQTSLQFPQIQRFDEHFVLDILVDDGHVRGLVAMNMMEGTLVQIRANAVVMATGGAGRVYRYNTNGGIVTGDGMGMALSHGVPLRDMEFVQYHPAGLPGSGILMTEGC---------------------------------------RDKVSQAFWHEWRKGNTIS----------------KKLHE---FICELAKAY----------PVRPTAHYTMGGIETDQNCETRIKGLFAVGECSSVGLHGANRLGSNSLAELVVFGRLAGEQATERAATAGNGNEAAIEAQAAGVEQRLKDLVNQDGGENWAKIRDEMGLAMEEGCGIYRTPELMQKTIDKLAELQERFKRVRITDTSSVFNTDLLYTIELGHGLNVAECMAHSAMARKESRGAHQRLDEGCTERDDVNFLKHTLAFRDADGTTRLEYSDVKIT 571
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       | -         -         -         -       289       299     |   -         -  |   |  -|       |-       349       359       369       379       389       399       409       419       429       439       449       459       469       479       489       499       509       519       529       539       549       559       569  
                                                                                                                                                                                                                                                                                 247                                     287               305              322 326 330     338        349                                                                                                                                                                                                                              


Chain N from PDB  Type:PROTEIN  Length:243
 aligned with FRDB_ECOLI | P0AC47 from UniProtKB/Swiss-Prot  Length:244

    Alignment length:243
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241   
           FRDB_ECOLI     2 AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR 244
               SCOP domains d3cirn2 N:1-105 Fumarate reductase iron-sulfur protein, N-terminal domain                                d3cirn1 N:106-243 Fumarate reductase                                                                                                       SCOP domains
               CATH domains -3cirN01 N:2-105  [code=3.10.20.30, no name defined]                                                     3cirN02 N:106-243 Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2                                                                CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeeee.........eeeeeeeee....hhhhhhhhhhhhh...................eee..........hhhhh....eeee....eeee..ee.hhhhhhhhhh..........hhhhh....hhhhhhhhhh.......hhhhhhhhhhhhh....hhhhhhhhhhhhh......hhhhhhhhh...hhhhh...hhhhhhh....hhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --------------2FE2S_FER_2  PDB: N:15-96 UniProt: 16-97                                          ------------------------------------------4FE4S_FER_2  PDB: N:139-168   --------------------------------------------------------------------------- PROSITE (1)
                PROSITE (2) --------------------------------------------------------2FE2S_FER----------------------------------------------------------------------------------4FE4S_FER_1 ------------------------------------------------------------------------------------ PROSITE (2)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3cir N   1 AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR 243
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240   


Chain O from PDB  Type:PROTEIN  Length:130
 aligned with FRDC_ECOLI | P0A8Q0 from UniProtKB/Swiss-Prot  Length:131

    Alignment length:130
                                    11        21        31        41        51        61        71        81        91       101       111       121       131
           FRDC_ECOLI     2 TTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKNGPEAWAGFVDFLQNPVIVIINLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKSLWAVTVVATIVILFVALYW 131
               SCOP domains d3ciro1 O:1-130 Fumarate reductase subunit FrdC                                                                                    SCOP domains
               CATH domains 3cirO00 O:1-130 Fumarate reductase respiratory complex transmembrane subunits                                                      CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......ee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..ee..ee..hhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3cir O   1 TTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKNGPEAWAGFVDFLQNPVIVIINLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKSLWAVTVVATIVILFVALYW 130
                                    10        20        30        40        50        60        70        80        90       100       110       120       130


Chain P from PDB  Type:PROTEIN  Length:119
 aligned with FRDD_ECOLI | P0A8Q3 from UniProtKB/Swiss-Prot  Length:119

    Alignment length:119
                                    10        20        30        40        50        60        70        80        90       100       110         
           FRDD_ECOLI     1 MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQSFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGVVTI 119
               SCOP domains d3cirp1 P:0-118 Fumarate reductase subunit FrdD                                                                         SCOP domains
               CATH domains 3cirP00 P:0-118 Fumarate reductase respiratory complex transmembrane subunits                                           CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript
                 3cir P   0 MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQSFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGVVTI 118
                                     9        19        29        39        49        59        69        79        89        99       109
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (7, 14)

Asymmetric Unit
(-)
Class: All alpha proteins (14657)
(-)
Class: Alpha and beta proteins (a+b) (23004)
(-)
Class: Alpha and beta proteins (a/b) (23833)
(-)
Class: Membrane and cell surface proteins and peptides (2046)

(-) CATH Domains  (6, 14)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Few Secondary Structures (1120)
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3CIR)

(-) Gene Ontology  (28, 56)

Asymmetric Unit(hide GO term definitions)
Chain A,M   (FRDA_ECOLI | P00363)
molecular function
    GO:0071949    FAD binding    Interacting selectively and non-covalently with the oxidized form, FAD, of flavin-adenine dinucleotide, the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes.
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0050660    flavin adenine dinucleotide binding    Interacting selectively and non-covalently with FAD, flavin-adenine dinucleotide, the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes, in either the oxidized form, FAD, or the reduced form, FADH2.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0016627    oxidoreductase activity, acting on the CH-CH group of donors    Catalysis of an oxidation-reduction (redox) reaction in which a CH-CH group acts as a hydrogen or electron donor and reduces a hydrogen or electron acceptor.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0000104    succinate dehydrogenase activity    Catalysis of the reaction: succinate + acceptor = fumarate + reduced acceptor.
biological process
    GO:0009061    anaerobic respiration    The enzymatic release of energy from inorganic and organic compounds (especially carbohydrates and fats) which uses compounds other than oxygen (e.g. nitrate, sulfate) as the terminal electron acceptor.
    GO:0044780    bacterial-type flagellum assembly    The assembly of a bacterial-type flagellum, a motor complex composed of an extracellular helical protein filament coupled to a rotary motor embedded in the cell envelope which functions in cell motility.
    GO:0071973    bacterial-type flagellum-dependent cell motility    Cell motility due to the motion of one or more bacterial-type flagella. A bacterial-type flagellum is a motor complex composed of an extracellular helical protein filament coupled to a rotary motor embedded in the cell envelope.
    GO:0006974    cellular response to DNA damage stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
    GO:0022900    electron transport chain    A process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0006113    fermentation    The anaerobic enzymatic conversion of organic compounds, especially carbohydrates, coupling the oxidation and reduction of NAD/H and the generation of adenosine triphosphate (ATP).
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0045284    plasma membrane fumarate reductase complex    A membrane-bound flavoenzyme complex consisting of four subunits, A, B, C, and D. A and B comprise the membrane-extrinsic catalytic domain and C (InterPro:IPR003510; InterPro:IPR00224) and D (InterPro:IPR003418) link the catalytic centers to the electron-transport chain. In some species, the complex has only three subunits, and in these cases, there is only one membrane anchor instead of two. This family consists of the 13 kDa hydrophobic subunit D. This component may be required to anchor the catalytic components of the fumarate reductase complex to the cytoplasmic membrane. Fumarate reductase couples the reduction of fumarate to succinate to the oxidation of quinol to quinone, in a reaction opposite to that catalyzed by the related complex II of the respiratory chain (succinate dehydrogenase-(ubiquinone)). Examples of this component are found in bacterial species.

Chain B,N   (FRDB_ECOLI | P0AC47)
molecular function
    GO:0051537    2 iron, 2 sulfur cluster binding    Interacting selectively and non-covalently with a 2 iron, 2 sulfur (2Fe-2S) cluster; this cluster consists of two iron atoms, with two inorganic sulfur atoms found between the irons and acting as bridging ligands.
    GO:0051538    3 iron, 4 sulfur cluster binding    Interacting selectively and non-covalently with a 3 iron, 4 sulfur (3Fe-4S) cluster; this cluster consists of three iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands. It is essentially a 4Fe-4S cluster with one iron missing.
    GO:0051539    4 iron, 4 sulfur cluster binding    Interacting selectively and non-covalently with a 4 iron, 4 sulfur (4Fe-4S) cluster; this cluster consists of four iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands.
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0051536    iron-sulfur cluster binding    Interacting selectively and non-covalently with an iron-sulfur cluster, a combination of iron and sulfur atoms.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0008177    succinate dehydrogenase (ubiquinone) activity    Catalysis of the reaction: succinate + ubiquinone = fumarate + ubiquinol.
    GO:0000104    succinate dehydrogenase activity    Catalysis of the reaction: succinate + acceptor = fumarate + reduced acceptor.
biological process
    GO:0009061    anaerobic respiration    The enzymatic release of energy from inorganic and organic compounds (especially carbohydrates and fats) which uses compounds other than oxygen (e.g. nitrate, sulfate) as the terminal electron acceptor.
    GO:0044780    bacterial-type flagellum assembly    The assembly of a bacterial-type flagellum, a motor complex composed of an extracellular helical protein filament coupled to a rotary motor embedded in the cell envelope which functions in cell motility.
    GO:0071973    bacterial-type flagellum-dependent cell motility    Cell motility due to the motion of one or more bacterial-type flagella. A bacterial-type flagellum is a motor complex composed of an extracellular helical protein filament coupled to a rotary motor embedded in the cell envelope.
    GO:0006113    fermentation    The anaerobic enzymatic conversion of organic compounds, especially carbohydrates, coupling the oxidation and reduction of NAD/H and the generation of adenosine triphosphate (ATP).
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0006099    tricarboxylic acid cycle    A nearly universal metabolic pathway in which the acetyl group of acetyl coenzyme A is effectively oxidized to two CO2 and four pairs of electrons are transferred to coenzymes. The acetyl group combines with oxaloacetate to form citrate, which undergoes successive transformations to isocitrate, 2-oxoglutarate, succinyl-CoA, succinate, fumarate, malate, and oxaloacetate again, thus completing the cycle. In eukaryotes the tricarboxylic acid is confined to the mitochondria. See also glyoxylate cycle.
cellular component
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0045284    plasma membrane fumarate reductase complex    A membrane-bound flavoenzyme complex consisting of four subunits, A, B, C, and D. A and B comprise the membrane-extrinsic catalytic domain and C (InterPro:IPR003510; InterPro:IPR00224) and D (InterPro:IPR003418) link the catalytic centers to the electron-transport chain. In some species, the complex has only three subunits, and in these cases, there is only one membrane anchor instead of two. This family consists of the 13 kDa hydrophobic subunit D. This component may be required to anchor the catalytic components of the fumarate reductase complex to the cytoplasmic membrane. Fumarate reductase couples the reduction of fumarate to succinate to the oxidation of quinol to quinone, in a reaction opposite to that catalyzed by the related complex II of the respiratory chain (succinate dehydrogenase-(ubiquinone)). Examples of this component are found in bacterial species.

Chain C,O   (FRDC_ECOLI | P0A8Q0)
molecular function
    GO:0008177    succinate dehydrogenase (ubiquinone) activity    Catalysis of the reaction: succinate + ubiquinone = fumarate + ubiquinol.
    GO:0000104    succinate dehydrogenase activity    Catalysis of the reaction: succinate + acceptor = fumarate + reduced acceptor.
biological process
    GO:0009061    anaerobic respiration    The enzymatic release of energy from inorganic and organic compounds (especially carbohydrates and fats) which uses compounds other than oxygen (e.g. nitrate, sulfate) as the terminal electron acceptor.
    GO:0044780    bacterial-type flagellum assembly    The assembly of a bacterial-type flagellum, a motor complex composed of an extracellular helical protein filament coupled to a rotary motor embedded in the cell envelope which functions in cell motility.
    GO:0071973    bacterial-type flagellum-dependent cell motility    Cell motility due to the motion of one or more bacterial-type flagella. A bacterial-type flagellum is a motor complex composed of an extracellular helical protein filament coupled to a rotary motor embedded in the cell envelope.
    GO:0006113    fermentation    The anaerobic enzymatic conversion of organic compounds, especially carbohydrates, coupling the oxidation and reduction of NAD/H and the generation of adenosine triphosphate (ATP).
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0045284    plasma membrane fumarate reductase complex    A membrane-bound flavoenzyme complex consisting of four subunits, A, B, C, and D. A and B comprise the membrane-extrinsic catalytic domain and C (InterPro:IPR003510; InterPro:IPR00224) and D (InterPro:IPR003418) link the catalytic centers to the electron-transport chain. In some species, the complex has only three subunits, and in these cases, there is only one membrane anchor instead of two. This family consists of the 13 kDa hydrophobic subunit D. This component may be required to anchor the catalytic components of the fumarate reductase complex to the cytoplasmic membrane. Fumarate reductase couples the reduction of fumarate to succinate to the oxidation of quinol to quinone, in a reaction opposite to that catalyzed by the related complex II of the respiratory chain (succinate dehydrogenase-(ubiquinone)). Examples of this component are found in bacterial species.

Chain D,P   (FRDD_ECOLI | P0A8Q3)
molecular function
    GO:0008177    succinate dehydrogenase (ubiquinone) activity    Catalysis of the reaction: succinate + ubiquinone = fumarate + ubiquinol.
    GO:0000104    succinate dehydrogenase activity    Catalysis of the reaction: succinate + acceptor = fumarate + reduced acceptor.
biological process
    GO:0009061    anaerobic respiration    The enzymatic release of energy from inorganic and organic compounds (especially carbohydrates and fats) which uses compounds other than oxygen (e.g. nitrate, sulfate) as the terminal electron acceptor.
    GO:0006113    fermentation    The anaerobic enzymatic conversion of organic compounds, especially carbohydrates, coupling the oxidation and reduction of NAD/H and the generation of adenosine triphosphate (ATP).
    GO:0006106    fumarate metabolic process    The chemical reactions and pathways involving fumarate, the anion of trans-1,2-ethenedicarboxylic acid, the diastereoisomer of maleate. It is a key intermediate in metabolism and is formed in the TCA cycle from succinate and converted into malate.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005887    integral component of plasma membrane    The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0045284    plasma membrane fumarate reductase complex    A membrane-bound flavoenzyme complex consisting of four subunits, A, B, C, and D. A and B comprise the membrane-extrinsic catalytic domain and C (InterPro:IPR003510; InterPro:IPR00224) and D (InterPro:IPR003418) link the catalytic centers to the electron-transport chain. In some species, the complex has only three subunits, and in these cases, there is only one membrane anchor instead of two. This family consists of the 13 kDa hydrophobic subunit D. This component may be required to anchor the catalytic components of the fumarate reductase complex to the cytoplasmic membrane. Fumarate reductase couples the reduction of fumarate to succinate to the oxidation of quinol to quinone, in a reaction opposite to that catalyzed by the related complex II of the respiratory chain (succinate dehydrogenase-(ubiquinone)). Examples of this component are found in bacterial species.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    F3S  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FAD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FES  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SF4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3cir)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3cir
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FRDA_ECOLI | P00363
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  FRDB_ECOLI | P0AC47
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  FRDC_ECOLI | P0A8Q0
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  FRDD_ECOLI | P0A8Q3
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.3.99.1
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  FRDA_ECOLI | P00363
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  FRDB_ECOLI | P0AC47
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  FRDC_ECOLI | P0A8Q0
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  FRDD_ECOLI | P0A8Q3
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        FRDA_ECOLI | P00363: 1kf6 1kfy 1l0v 2b76 3p4p 3p4q 3p4r 3p4s 4kx6 5vpn
        FRDB_ECOLI | P0AC47: 1kf6 1kfy 1l0v 2b76 3p4p 3p4q 3p4r 3p4s
        FRDC_ECOLI | P0A8Q0: 1kf6 1kfy 1l0v 2b76 3p4p 3p4q 3p4r 3p4s 5vpn
        FRDD_ECOLI | P0A8Q3: 1kf6 1kfy 1l0v 2b76 3p4p 3p4q 3p4r 3p4s 4kx6 5vpn

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3CIR)