Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  SEQUENCING A PROTEIN BY X-RAY CRYSTALLOGRAPHY. II. REFINEMENT OF YEAST HEXOKINASE B CO-ORDINATES AND SEQUENCE AT 2.1 ANGSTROMS RESOLUTION
 
Authors :  T. A. Steitz, C. M. Anderson, R. E. Stenkamp
Date :  20 Mar 78  (Deposition) - 23 May 78  (Release) - 25 Aug 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.10
Chains :  Asym./Biol. Unit :  A
Keywords :  Transferase(Phosphoryl, Alcohol Acceptr) (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  C. M. Anderson, R. E. Stenkamp, T. A. Steitz
Sequencing A Protein By X-Ray Crystallography. Ii. Refinement Of Yeast Hexokinase B Co-Ordinates And Sequence At 2. 1 A Resolution.
J. Mol. Biol. V. 123 15 1978
PubMed-ID: 355643  |  Reference-DOI: 10.1016/0022-2836(78)90374-1
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - HEXOKINASE B
    Chains: A
    EC Number: 2.7.1.1
    Engineered: YES
    Organism Common: BAKER'S YEAST
    Organism Scientific: SACCHAROMYCES CEREVISIAE
    Organism Taxid: 4932

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 79)

Asymmetric/Biological Unit (2, 79)
No.NameCountTypeFull Name
1OTG1Ligand/IonORTHO-TOLUOYLGLUCOSAMINE
2UNK78Mod. Amino Acid

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREUNK A:188 , ASP A:189 , GLY A:213 , VAL A:214 , ASN A:215 , ASP A:245 , SER A:247 , LYS A:274 , UNK A:277BINDING SITE FOR RESIDUE OTG A 1

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2YHX)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2YHX)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2YHX)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2YHX)

(-) Exons   (0, 0)

(no "Exon" information available for 2YHX)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:457
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                         
               SCOP domains d2yhxa_ A: Hexokinase                                                                                                                                                                                                                                                                                                                                                                                                                                                     SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhh.......ee............eeeeeeee...eeeeeeeeee..eeeeeeeeee..........hhhhhhhhhhhhhhhhhhhh......eeeeee.............................hhhhhhhhhhhhhh.eeeeeeehhhhhhhhhhhhhh..eeeeeee...eeeeeeehhhhh..............eeee...............hhhhhhhhhhh....hhhhhhhh..hhhhhhhhhhhhhhhh..................hhhhhhhhhh....hhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeee.......hhhhhhhhhhhhhhh....hhhhh.eeeee.....hhhhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2yhx A   2 AAAxDxSLVEVHxxVFIVPPxILQAVVSILTTRxDDxDSSAASIPMVPGWVLKQVSGAQAGSFLAIVMGGGDLEVILISLAGRQESSIxASRSLAAAMSTTAIPSDLWGNxAxSNAAFSSxEFSSxAGSVPLGFTFxEAGAKExVIKGQITxQAxAFSLAxLxKLISAMxNAxFPAGDxxxSVADIxDSHGILxxVNYTDAxIKMGIIFGSGVNAAYWCDSTxIGDAADGGxxGGAGxMxICCDQSSFRKAFPSLPQIxYLxTLNxxSPxAxKTFxKNSxAKNxGQSLRDVLMxFKxxGQxHxxxAxSFxAANVENTSYPAKIQKLPHFDLRxxxDLFxGDQGIAxKTxMKxVVRRxLFLIAAYAFRLVVCxIxAICQKKGYSSGHIAAxGSxRSYSGFSxNSATxNxNIYGWPQSAxxSKPIxITPAIDGxGAASxVIxSIASAxxSxAxxSAxxA 458
                               | |  11  ||    21|       31   |  | 41        51        61        71        81        91       101       111| |    121|    | 131      |141   |   151 |  |  161| |    171  |    181|     |191   ||  201 |     211       221  |    231 ||    241       251       261 |   ||271 |   | 281   |   291   |  |301| ||| |311       321       331  |||  341     | 351 |    |361       371 | |   381       391  |    401|    | 411       421   |   431 |    |441     ||451||  || 
                               | |     14-UNK  22-UNK       35-UNK                                                 90-UNK               112-UNK   122-UNK|        138-UNK  |     153-UNK    | |      |  |     |||     |     196-UNK  |                  224-UNK  233-UNK | |                260-UNK  ||  | |   |   |   |       295-UNK  | ||| |  |                    334-UNK |      |  |  |    |            373-UNK           391-UNK    402-UNK| |       419-UNK |     433-UNK|  |     || | || 457-UNK
                               5-UNK    15-UNK                 38-UNK                                                                     114-UNK      127-UNK           145-UNK    156-UNK | |      |  |     |||     |      |     203-UNK                        234-UNK| |                   263-UNK|  | |   |   |   |          298-UNK ||| |  |                     335-UNK|      |  |  |    |              375-UNK            394-UNK      407-UNK      420-UNK|          438-UNK    || | ||  |  
                                 7-UNK                                                                                                                                                    162-UNK    |  |     |||     |      |                                         239-UNK                     267-UNK |   |   |   |           299-UNK||| |  |                      336-UNK      |  |  |    |                                                409-UNK         425-UNK         441-UNK || | ||  |  
                                                                                                                                                                                            164-UNK  |  |     |||     |      |                                           241-UNK                    268-UNK|   |   |   |              302-UNK |  |                          340-UNK  |  |  |    |                                                                                      447-UNK||  |  
                                                                                                                                                                                                   171-UNK    |||     |      |                                                                         271-UNK |   |   |                304-UNK  |                                 347-UNK |    |                                                                                       448-UNK|  |  
                                                                                                                                                                                                      174-UNK |||     |      |                                                                           273-UNK   |   |                 305-UNK |                                    350-UNK   |                                                                                         450-UNK |  
                                                                                                                                                                                                            180-UNK   |      |                                                                               277-UNK   |                  306-UNK|                                       353-UNK|                                                                                           452-UNK  
                                                                                                                                                                                                             181-UNK  |      |                                                                                   281-UNK                    308-UNK                                           358-UNK                                                                                        453-UNK 
                                                                                                                                                                                                              182-UNK |      |                                                                                       285-UNK                   311-UNK                                                                                                                                          456-UNK
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Low resolution protein structures (283)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2YHX)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2YHX)

(-) Gene Ontology  (29, 29)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    OTG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    UNK  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2yhx)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2yhx
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  HXKB_YEAST | P04807
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.1.1
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  HXKB_YEAST | P04807
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        HXKB_YEAST | P04807: 1ig8 5uwt

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2YHX)