|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2RST) |
Sites (0, 0)| (no "Site" information available for 2RST) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2RST) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2RST) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2RST) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2RST) |
Exons (0, 0)| (no "Exon" information available for 2RST) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:132 aligned with O96048_LUMTE | O96048 from UniProtKB/TrEMBL Length:260 Alignment length:132 138 148 158 168 178 188 198 208 218 228 238 248 258 O96048_LUMTE 129 LKPKFFYIKSELNGKVLDIEGQNPAPGSKIITWDQKKGPTAVNQLWYTDQQGVIRSKLNDFAIDASHEQIETQPFDPNNPKRAWIVSGNTIAQLSDRDIVLDIIKSDKEAGAHICAWKQHGGPNQKFIIESE 260 SCOP domains d2rsta_ A: 29-kDa galactose-binding lectin SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------ Transcript 2rst A 1 MKPKFFYIKSELNGKVLDIEGQNPAPGSKIITWDQKKGPTAVNQLWYTDQQGVIRSKLNDFAIDASHEQIETQPFDPNNPKRAWIVSGNTIAQLSDRDIVLDIIKSDKEAGAHICAWKQHGGPNQKFIIESE 132 10 20 30 40 50 60 70 80 90 100 110 120 130
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2RST) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2RST) |
Gene Ontology (1, 1)|
NMR Structure(hide GO term definitions) Chain A (O96048_LUMTE | O96048)
|
||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|