|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 2QHB) |
(no "Site" information available for 2QHB) |
(no "SS Bond" information available for 2QHB) |
(no "Cis Peptide Bond" information available for 2QHB) |
(no "SAP(SNP)/Variant" information available for 2QHB) |
(no "PROSITE Motif" information available for 2QHB) |
(no "Exon" information available for 2QHB) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:86 aligned with Q84ZU4_NICGU | Q84ZU4 from UniProtKB/TrEMBL Length:681 Alignment length:86 583 593 603 613 623 633 643 653 Q84ZU4_NICGU 574 RRIRRPFSVAEVEALVEAVEHLGTGRWRDVKMRAFDNADHRTYVDLKDKWKTLVHTASIAPQQRRGEPVPQDLLDRVLAAHAYWSQ 659 SCOP domains d2qhba_ A: Telomere binding protein TBP1 SCOP domains CATH domains -------------------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------- Transcript 2qhb A 574 RRIRRPFSVAEVEALVEAVEHLGTGRWRDVKMRAFDNADHRTYVDLKDKWKTLVHTASIAPQQRRGEPVPQDLLDRVLAAHAYWSQ 659 583 593 603 613 623 633 643 653 Chain B from PDB Type:PROTEIN Length:85 aligned with Q84ZU4_NICGU | Q84ZU4 from UniProtKB/TrEMBL Length:681 Alignment length:85 584 594 604 614 624 634 644 654 Q84ZU4_NICGU 575 RIRRPFSVAEVEALVEAVEHLGTGRWRDVKMRAFDNADHRTYVDLKDKWKTLVHTASIAPQQRRGEPVPQDLLDRVLAAHAYWSQ 659 SCOP domains d2qhbb_ B: Telomere binding protein TBP1 SCOP domains CATH domains ------------------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------- Transcript 2qhb B 575 RIRRPFSVAEVEALVEAVEHLGTGRWRDVKMRAFDNADHRTYVDLKDKWKTLVHTASIAPQQRRGEPVPQDLLDRVLAAHAYWSQ 659 584 594 604 614 624 634 644 654 Chain C from PDB Type:DNA Length:7 2qhb C 1 TTTAGGG 7 Chain D from PDB Type:DNA Length:7 2qhb D 8 CCCTAAA 14 Chain E from PDB Type:DNA Length:7 2qhb E 1 TTTAGGG 7 Chain F from PDB Type:DNA Length:7 2qhb F 8 CCCTAAA 14
|
Asymmetric Unit
|
(no "CATH Domain" information available for 2QHB) |
(no "Pfam Domain" information available for 2QHB) |
Asymmetric Unit(hide GO term definitions) Chain A,B (Q84ZU4_NICGU | Q84ZU4)
|
|
|
|
|
|
|