|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 3)| Asymmetric/Biological Unit (2, 3) |
Sites (3, 3)
Asymmetric Unit (3, 3)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2PYA) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2PYA) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2PYA) |
PROSITE Motifs (1, 1)
Asymmetric/Biological Unit (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2PYA) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:52 aligned with RUBR_PYRAB | Q9V099 from UniProtKB/Swiss-Prot Length:53 Alignment length:52 11 21 31 41 51 RUBR_PYRAB 2 AKWRCKICGYIYDEDEGDPDNGISPGTKFEDLPDDWVCPLCGAPKSEFERIE 53 SCOP domains d2pyaa_ A: Rubredoxin SCOP domains CATH domains 2pyaA00 A:2-53 [code=2.20.28.10, no name defined] CATH domains Pfam domains ----Rubredoxin-2pyaA01 A:6-49 ---- Pfam domains SAPs(SNPs) ---------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------RUBREDOXIN ---------- PROSITE Transcript ---------------------------------------------------- Transcript 2pya A 2 AKLSCKICGYIYDEDEGDPDNGISPGTKFEDLPDDWVCPLCGSPKSEFERIE 53 11 21 31 41 51
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (1, 1)
Asymmetric/Biological Unit
|
Pfam Domains (1, 1)| Asymmetric/Biological Unit |
Gene Ontology (4, 4)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (RUBR_PYRAB | Q9V099)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|