|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 3) Biological Unit 1 (2, 6) |
Asymmetric Unit (2, 2)
|
(no "SS Bond" information available for 2PEG) |
(no "Cis Peptide Bond" information available for 2PEG) |
(no "SAP(SNP)/Variant" information available for 2PEG) |
Asymmetric Unit (1, 2) Biological Unit 1 (1, 4) |
(no "Exon" information available for 2PEG) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:143 aligned with HBA_TREBE | P80043 from UniProtKB/Swiss-Prot Length:142 Alignment length:143 1 | 9 19 29 39 49 59 69 79 89 99 109 119 129 139 HBA_TREBE - -SLSDKDKAAVRALWSKIGKSADAIGNDALSRMIVVYPQTKTYFSHWPDVTPGSPHIKAHGKKVMGGIALAVSKIDDLKTGLMELSEQHAYKLRVDPANFKILNHCILVVISTMFPKEFTPEAHVSLDKFLSGVALALAERYR 142 SCOP domains d2pega_ A: Hemoglobin, alpha-chain SCOP domains CATH domains -2pegA00 A:1-142 Globins CATH domains Pfam domains ------Globin-2pegA01 A:6-107 ----------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --GLOBIN PDB: A:2-142 UniProt: 2-142 PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2peg A 0 xSLSDKDKAAVRALWSKIGKSADAIGNDALSRMIVVYPQTKTYFSHWPDVTPGSPHIKAHGKKVMGGIALAVSKIDDLKTGLMELSEQHAYKLRVDPANFKILNHCILVVISTMFPKEFTPEAHVSLDKFLSGVALALAERYR 142 | 9 19 29 39 49 59 69 79 89 99 109 119 129 139 | 0-ACE Chain B from PDB Type:PROTEIN Length:141 aligned with HBB_TREBE | P80044 from UniProtKB/Swiss-Prot Length:147 Alignment length:146 11 21 31 41 51 61 71 81 91 101 111 121 131 141 HBB_TREBE 2 VEWTDKERSIISDIFSHMDYDDIGPKALSRCLIVYPWTQRHFSGFGNLYNAEAIIGNANVAAHGIKVLHGLDRGVKNMDNIAATYADLSTLHSEKLHVDPDNFKLLSDCITIVLAAKMGHAFTAETQGAFQKFLAVVVSALGKQYH 147 SCOP domains d2pegb_ B: Hemoglobin, beta-chain SCOP domains CATH domains 2pegB00 B:1-146 Globins CATH domains Pfam domains ------Globin-2pegB01 B:7-111 ----------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (2) ---GLOBIN PDB: B:4-146 UniProt: 5-147 PROSITE (2) Transcript -------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2peg B 1 VEWTDKERSIISDIFSHMDYDDIGPKALSRCLIVYPWTQRHFSG-----NAEAIIGNANVAAHGIKVLHGLDRGVKNMDNIAATYADLSTLHSEKLHVDPDNFKLLSDCITIVLAAKMGHAFTAETQGAFQKFLAVVVSALGKQYH 146 10 20 30 40 | 50 60 70 80 90 100 110 120 130 140 44 50
|
Asymmetric Unit |
Asymmetric Unit
|
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A (HBA_TREBE | P80043)
Chain B (HBB_TREBE | P80044)
|
|
|
|
|
|
|