Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF THE SKP1-FBW7 COMPLEX
 
Authors :  B. Hao, S. Oehlmann, M. E. Sowa, J. W. Harper, N. P. Pavletich
Date :  14 Feb 07  (Deposition) - 24 Apr 07  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.90
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  A,B  (4x)
Keywords :  F-Box; Wd40 Domains, Transcription/Cell Cycle Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  B. Hao, S. Oehlmann, M. E. Sowa, J. W. Harper, N. P. Pavletich
Structure Of A Fbw7-Skp1-Cyclin E Complex: Multisite-Phosphorylated Substrate Recognition By Scf Ubiquitin Ligases
Mol. Cell V. 26 131 2007
PubMed-ID: 17434132  |  Reference-DOI: 10.1016/J.MOLCEL.2007.02.022
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - S-PHASE KINASE-ASSOCIATED PROTEIN 1A
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21
    Expression System PlasmidENGINEERED PGEX VECTOR
    Expression System StrainBL21
    Expression System Taxid511693
    Expression System Vector TypePLASMID
    FragmentRESIDUES 1-147
    GeneSKP1A, EMC19, OCP2, SKP1, TCEB1L
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymSKP1;
CYCLIN A/CDK2-ASSOCIATED PROTEIN P19;
P19A
 
Molecule 2 - F-BOX/WD REPEAT PROTEIN 7
    ChainsB
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21
    Expression System PlasmidENGINEERED PGEX VECTOR
    Expression System StrainBL21
    Expression System Taxid511693
    Expression System Vector TypePLASMID
    FragmentN-TERMINAL RESIDUES 263-707
    GeneFBXW7, FBW7, FBX30, SEL10
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymFBW7

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)AB
Biological Unit 2 (4x)AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2OVP)

(-) Sites  (0, 0)

(no "Site" information available for 2OVP)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2OVP)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2OVP)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (9, 9)

Asymmetric Unit (9, 9)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_051999F14LSKP1_HUMANPolymorphism11538034AF1014L
2UniProtVAR_017815R465CFBXW7_HUMANUnclassified867384286BR2465C
3UniProtVAR_035880R465HFBXW7_HUMANUnclassified  ---BR2465H
4CancerSNPVAR_FBXW7_HUMAN_CCDS3777_1_02 *R465HFBXW7_HUMANDisease (Colorectal cancer)  ---BR2465H
5UniProtVAR_017816R505LFBXW7_HUMANUnclassified  ---BR2505L
6CancerSNPVAR_FBXW7_HUMAN_CCDS3777_1_03 *R505LFBXW7_HUMANDisease (Colorectal cancer)  ---BR2505L
7UniProtVAR_035881S582LFBXW7_HUMANUnclassified  ---BS2582L
8CancerSNPVAR_FBXW7_HUMAN_CCDS3777_1_04 *S582LFBXW7_HUMANDisease (Colorectal cancer)  ---BS2582L
9UniProtVAR_017817S668GFBXW7_HUMANPolymorphism7679116BS2668G
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (9, 9)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_051999F14LSKP1_HUMANPolymorphism11538034AF1014L
2UniProtVAR_017815R465CFBXW7_HUMANUnclassified867384286BR2465C
3UniProtVAR_035880R465HFBXW7_HUMANUnclassified  ---BR2465H
4CancerSNPVAR_FBXW7_HUMAN_CCDS3777_1_02 *R465HFBXW7_HUMANDisease (Colorectal cancer)  ---BR2465H
5UniProtVAR_017816R505LFBXW7_HUMANUnclassified  ---BR2505L
6CancerSNPVAR_FBXW7_HUMAN_CCDS3777_1_03 *R505LFBXW7_HUMANDisease (Colorectal cancer)  ---BR2505L
7UniProtVAR_035881S582LFBXW7_HUMANUnclassified  ---BS2582L
8CancerSNPVAR_FBXW7_HUMAN_CCDS3777_1_04 *S582LFBXW7_HUMANDisease (Colorectal cancer)  ---BS2582L
9UniProtVAR_017817S668GFBXW7_HUMANPolymorphism7679116BS2668G
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (9, 36)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_051999F14LSKP1_HUMANPolymorphism11538034AF1014L
2UniProtVAR_017815R465CFBXW7_HUMANUnclassified867384286BR2465C
3UniProtVAR_035880R465HFBXW7_HUMANUnclassified  ---BR2465H
4CancerSNPVAR_FBXW7_HUMAN_CCDS3777_1_02 *R465HFBXW7_HUMANDisease (Colorectal cancer)  ---BR2465H
5UniProtVAR_017816R505LFBXW7_HUMANUnclassified  ---BR2505L
6CancerSNPVAR_FBXW7_HUMAN_CCDS3777_1_03 *R505LFBXW7_HUMANDisease (Colorectal cancer)  ---BR2505L
7UniProtVAR_035881S582LFBXW7_HUMANUnclassified  ---BS2582L
8CancerSNPVAR_FBXW7_HUMAN_CCDS3777_1_04 *S582LFBXW7_HUMANDisease (Colorectal cancer)  ---BS2582L
9UniProtVAR_017817S668GFBXW7_HUMANPolymorphism7679116BS2668G
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 6)

Asymmetric Unit (2, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1FBOXPS50181 F-box domain profile.FBXW7_HUMAN278-324  1B:2278-2324
2WD_REPEATS_1PS00678 Trp-Asp (WD) repeats signature.FBXW7_HUMAN434-448
474-488
554-568
594-608
637-651
  5B:2434-2448
B:2474-2488
B:2554-2568
B:2594-2608
B:2637-2651
Biological Unit 1 (2, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1FBOXPS50181 F-box domain profile.FBXW7_HUMAN278-324  1B:2278-2324
2WD_REPEATS_1PS00678 Trp-Asp (WD) repeats signature.FBXW7_HUMAN434-448
474-488
554-568
594-608
637-651
  5B:2434-2448
B:2474-2488
B:2554-2568
B:2594-2608
B:2637-2651
Biological Unit 2 (2, 24)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1FBOXPS50181 F-box domain profile.FBXW7_HUMAN278-324  4B:2278-2324
2WD_REPEATS_1PS00678 Trp-Asp (WD) repeats signature.FBXW7_HUMAN434-448
474-488
554-568
594-608
637-651
  20B:2434-2448
B:2474-2488
B:2554-2568
B:2594-2608
B:2637-2651

(-) Exons   (13, 13)

Asymmetric Unit (13, 13)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000002817081ENSE00001480632chr4:153456172-15345609380FBXW7_HUMAN-00--
1.2aENST000002817082aENSE00001200526chr4:153333024-153332455570FBXW7_HUMAN1-1671670--
1.5ENST000002817085ENSE00000740035chr4:153271276-15327119483FBXW7_HUMAN168-195280--
1.6ENST000002817086ENSE00000740036chr4:153268223-153268082142FBXW7_HUMAN195-242480--
1.7ENST000002817087ENSE00001002596chr4:153259088-153258954135FBXW7_HUMAN243-287451B:2263-228725
1.8ENST000002817088ENSE00000821077chr4:153253871-153253748124FBXW7_HUMAN288-329421B:2288-232942
1.9ENST000002817089ENSE00000821076chr4:153252020-153251884137FBXW7_HUMAN329-374461B:2329-2374 (gaps)46
1.10ENST0000028170810ENSE00000821075chr4:153250937-153250824114FBXW7_HUMAN375-412381B:2375-241238
1.11ENST0000028170811ENSE00000821074chr4:153249541-153249360182FBXW7_HUMAN413-473611B:2413-247361
1.12ENST0000028170812ENSE00000821073chr4:153247383-153247158226FBXW7_HUMAN473-548761B:2473-254876
1.13ENST0000028170813ENSE00000821072chr4:153245546-153245336211FBXW7_HUMAN549-619711B:2549-261971
1.14bENST0000028170814bENSE00001431204chr4:153244301-1532424101892FBXW7_HUMAN619-707891B:2619-270688

2.2aENST000003534112aENSE00001169035chr5:133512729-133512546184SKP1_HUMAN-00--
2.5bENST000003534115bENSE00000763313chr5:133509713-13350961797SKP1_HUMAN1-33331A:1002-103332
2.7ENST000003534117ENSE00002156080chr5:133502934-13350286174SKP1_HUMAN33-57251A:1033-1057 (gaps)25
2.8dENST000003534118dENSE00000763311chr5:133496821-133496678144SKP1_HUMAN58-105481A:1058-1105 (gaps)48
2.9dENST000003534119dENSE00001328116chr5:133494286-133494146141SKP1_HUMAN106-152471A:1106-115247
2.9lENST000003534119lENSE00001291683chr5:133493459-1334920821378SKP1_HUMAN153-163111A:1153-11597

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:134
 aligned with SKP1_HUMAN | P63208 from UniProtKB/Swiss-Prot  Length:163

    Alignment length:158
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151        
          SKP1_HUMAN      2 PSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQW  159
               SCOP domains d2ovpa2 A:1002-1065 Cyclin A/CDK2-as      sociated p45, Skp1                      -d2ovpa1 A:1085-1159 Cyclin A/CDK2-associated p45, Skp1                      SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee....eeee.......hhhhhhhhhh....------eeee...hhhhhhhhhhhhh..------------------....hhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhh.....hhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------L------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.5b  PDB: A:1002-1033     ------------------------Exon 2.8d  PDB: A:1058-1105 (gaps)              Exon 2.9d  PDB: A:1106-1152 UniProt: 106-152   2.9l    Transcript 2 (1)
           Transcript 2 (2) -------------------------------Exon 2.7 UniProt: 33-57  ------------------------------------------------------------------------------------------------------ Transcript 2 (2)
                2ovp A 1002 PSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMD------PVPLPNVNAAILKKVIQWCTHH------------------DIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQW 1159
                                  1011      1021      1031     |   -  |   1051      1061   |     -         -  |   1091      1101      1111      1121      1131      1141      1151        
                                                            1037   1044                 1065               1084                                                                           

Chain B from PDB  Type:PROTEIN  Length:441
 aligned with FBXW7_HUMAN | Q969H0 from UniProtKB/Swiss-Prot  Length:707

    Alignment length:444
                                   272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462       472       482       492       502       512       522       532       542       552       562       572       582       592       602       612       622       632       642       652       662       672       682       692       702    
         FBXW7_HUMAN    263 TQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDM  706
               SCOP domains d2ovpb1 B:2263-2364 F-box/WD repeat-containing protein 7, FBXW7                                       d2ovpb2 B:2365-2706 F-box/WD repeat-containing protein 7, FBXW7                                                                                                                                                                                                                                                                                        SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhhhh.....hhhhhhhhhhhhhhhh..hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhh.........---........hhhhhhhhhhhhhhhhhhh......eeee......eeeeeee..eeeeee....eeeee.....eeee.......eeeeee...eeeeee...eeeeee.....eeeeee.......eeeee..eeeee....eeeeee.......eeee.....eeeeee....eeeee....eeeeehhhheeeeee......eeeeee...eeeeee....eeeee.....eeeee......eeeeeee..eeeeee....eeeee....eeeeee.........eeeeee...eeeeee...eeeeee.....eeeeeee........eeeeeee...eeeeeee........eeeeee..... Sec.struct. author
             SAPs(SNPs) (1) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------C---------------------------------------L----------------------------------------------------------------------------L-------------------------------------------------------------------------------------G-------------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------H---------------------------------------L----------------------------------------------------------------------------L---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------H------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (3)
                    PROSITE ---------------FBOX  PDB: B:2278-2324 UniProt: 278-324        -------------------------------------------------------------------------------------------------------------WD_REPEATS_1   -------------------------WD_REPEATS_1   -----------------------------------------------------------------WD_REPEATS_1   -------------------------WD_REPEATS_1   ----------------------------WD_REPEATS_1   ------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.7  PDB: B:2263-228Exon 1.8  PDB: B:2288-2329                ---------------------------------------------Exon 1.10  PDB: B:2375-2412           Exon 1.11  PDB: B:2413-2473 UniProt: 413-473                 ---------------------------------------------------------------------------Exon 1.13  PDB: B:2549-2619 UniProt: 549-619                           --------------------------------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------Exon 1.9  PDB: B:2329-2374 (gaps)             --------------------------------------------------------------------------------------------------Exon 1.12  PDB: B:2473-2548 UniProt: 473-548                                ----------------------------------------------------------------------Exon 1.14b  PDB: B:2619-2706 UniProt: 619-707 [INCOMPLETE]                               Transcript 1 (2)
                2ovp B 2263 TQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIK---VIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDM 2706
                                  2272      2282      2292      2302      2312      2322      2332    | 2342      2352      2362      2372      2382      2392      2402      2412      2422      2432      2442      2452      2462      2472      2482      2492      2502      2512      2522      2532      2542      2552      2562      2572      2582      2592      2602      2612      2622      2632      2642      2652      2662      2672      2682      2692      2702    
                                                                                                   2337   |                                                                                                                                                                                                                                                                                                                                                                             
                                                                                                       2341                                                                                                                                                                                                                                                                                                                                                                             

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (4, 4)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2OVP)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2OVP)

(-) Gene Ontology  (60, 70)

Asymmetric Unit(hide GO term definitions)
Chain A   (SKP1_HUMAN | P63208)
molecular function
    GO:0008013    beta-catenin binding    Interacting selectively and non-covalently with the beta subunit of the catenin complex.
    GO:0097602    cullin family protein binding    Interacting selectively and non-covalently with any member of the cullin family, hydrophobic proteins that act as scaffolds for ubiquitin ligases (E3).
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0061630    ubiquitin protein ligase activity    Catalysis of the transfer of ubiquitin to a substrate protein via the reaction X-ubiquitin + S -> X + S-ubiquitin, where X is either an E2 or E3 enzyme, the X-ubiquitin linkage is a thioester bond, and the S-ubiquitin linkage is an amide bond: an isopeptide bond between the C-terminal glycine of ubiquitin and the epsilon-amino group of lysine residues in the substrate or, in the linear extension of ubiquitin chains, a peptide bond the between the C-terminal glycine and N-terminal methionine of ubiquitin residues.
    GO:0004842    ubiquitin-protein transferase activity    Catalysis of the transfer of ubiquitin from one protein to another via the reaction X-Ub + Y --> Y-Ub + X, where both X-Ub and Y-Ub are covalent linkages.
biological process
    GO:0038095    Fc-epsilon receptor signaling pathway    A series of molecular signals initiated by the binding of the Fc portion of immunoglobulin E (IgE) to an Fc-epsilon receptor on the surface of a signal-receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription. The Fc portion of an immunoglobulin is its C-terminal constant region.
    GO:0000086    G2/M transition of mitotic cell cycle    The mitotic cell cycle transition by which a cell in G2 commits to M phase. The process begins when the kinase activity of M cyclin/CDK complex reaches a threshold high enough for the cell cycle to proceed. This is accomplished by activating a positive feedback loop that results in the accumulation of unphosphorylated and active M cyclin/CDK complex.
    GO:0038061    NIK/NF-kappaB signaling    The process in which a signal is passed on to downstream components within the cell through the NIK-dependent processing and activation of NF-KappaB. Begins with activation of the NF-KappaB-inducing kinase (NIK), which in turn phosphorylates and activates IkappaB kinase alpha (IKKalpha). IKKalpha phosphorylates the NF-Kappa B2 protein (p100) leading to p100 processing and release of an active NF-KappaB (p52).
    GO:0031146    SCF-dependent proteasomal ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, with ubiquitin-protein ligation catalyzed by an SCF (Skp1/Cul1/F-box protein) complex, and mediated by the proteasome.
    GO:0050852    T cell receptor signaling pathway    A series of molecular signals initiated by the cross-linking of an antigen receptor on a T cell.
    GO:0016055    Wnt signaling pathway    The series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell and ending with a change in cell state.
    GO:0035518    histone H2A monoubiquitination    The modification of histone H2A by addition of a single ubiquitin group.
    GO:0051437    positive regulation of ubiquitin-protein ligase activity involved in regulation of mitotic cell cycle transition    Any process that activates, maintains or increases the rate of ubiquitin ligase activity that contributes to the regulation of the mitotic cell cycle phase transition.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0000209    protein polyubiquitination    Addition of multiple ubiquitin groups to a protein, forming a ubiquitin chain.
    GO:0016567    protein ubiquitination    The process in which one or more ubiquitin groups are added to a protein.
    GO:0002223    stimulatory C-type lectin receptor signaling pathway    Any series of molecular signals generated as a consequence of binding to a C-type lectin receptor capable of cellular activation.
    GO:0051403    stress-activated MAPK cascade    A series of molecular signals in which a stress-activated MAP kinase cascade relays one or more of the signals; MAP kinase cascades involve at least three protein kinase activities and culminate in the phosphorylation and activation of a MAP kinase.
    GO:0006511    ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
cellular component
    GO:0031467    Cul7-RING ubiquitin ligase complex    A ubiquitin ligase complex in which a cullin from the Cul7 subfamily and a RING domain protein form the catalytic core; substrate specificity is conferred by a Skp1 linker and an F-box protein.
    GO:0031519    PcG protein complex    A chromatin-associated multiprotein complex containing Polycomb Group proteins. In Drosophila, Polycomb group proteins are involved in the long-term maintenance of gene repression, and PcG protein complexes associate with Polycomb group response elements (PREs) in target genes to regulate higher-order chromatin structure.
    GO:0019005    SCF ubiquitin ligase complex    A ubiquitin ligase complex in which a cullin from the Cul1 subfamily and a RING domain protein form the catalytic core; substrate specificity is conferred by a Skp1 adaptor and an F-box protein. SCF complexes are involved in targeting proteins for degradation by the proteasome. The best characterized complexes are those from yeast and mammals (with core subunits named Cdc53/Cul1, Rbx1/Hrt1/Roc1).
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain B   (FBXW7_HUMAN | Q969H0)
molecular function
    GO:0030332    cyclin binding    Interacting selectively and non-covalently with cyclins, proteins whose levels in a cell varies markedly during the cell cycle, rising steadily until mitosis, then falling abruptly to zero. As cyclins reach a threshold level, they are thought to drive cells into G2 phase and thus to mitosis.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0050816    phosphothreonine residue binding    Interacting selectively and non-covalently with a phosphorylated threonine residue within a protein.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0030674    protein binding, bridging    The binding activity of a molecule that brings together two or more protein molecules, or a protein and another macromolecule or complex, through a selective, non-covalent, often stoichiometric interaction, permitting those molecules to function in a coordinated way.
    GO:0031625    ubiquitin protein ligase binding    Interacting selectively and non-covalently with a ubiquitin protein ligase enzyme, any of the E3 proteins.
    GO:0097027    ubiquitin-protein transferase activator activity    Increases the activity of a ubiquitin-protein transferase, an enzyme that catalyzes the covalent attachment of ubiquitin to lysine in a substrate protein.
    GO:0004842    ubiquitin-protein transferase activity    Catalysis of the transfer of ubiquitin from one protein to another via the reaction X-Ub + Y --> Y-Ub + X, where both X-Ub and Y-Ub are covalent linkages.
biological process
    GO:0031146    SCF-dependent proteasomal ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, with ubiquitin-protein ligation catalyzed by an SCF (Skp1/Cul1/F-box protein) complex, and mediated by the proteasome.
    GO:0006974    cellular response to DNA damage stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
    GO:0034644    cellular response to UV    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an ultraviolet radiation (UV light) stimulus. Ultraviolet radiation is electromagnetic radiation with a wavelength in the range of 10 to 380 nanometers.
    GO:0055088    lipid homeostasis    Any process involved in the maintenance of an internal steady state of lipid within an organism or cell.
    GO:0032876    negative regulation of DNA endoreduplication    Any process that stops, prevents, or reduces the frequency, rate or extent of DNA endoreduplication.
    GO:0045746    negative regulation of Notch signaling pathway    Any process that stops, prevents, or reduces the frequency, rate or extent of the Notch signaling pathway.
    GO:2000639    negative regulation of SREBP signaling pathway    Any process that stops, prevents or reduces the frequency, rate or extent of the SREBP signaling pathway.
    GO:2000346    negative regulation of hepatocyte proliferation    Any process that stops, prevents or reduces the frequency, rate or extent of hepatocyte proliferation.
    GO:0010868    negative regulation of triglyceride biosynthetic process    Any process that decreases the rate, frequency, or extent of triglyceride biosynthesis. Triglyceride biosynthesis is the collection of chemical reactions and pathways resulting in the formation of triglyceride, any triester of glycerol.
    GO:0070374    positive regulation of ERK1 and ERK2 cascade    Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
    GO:0045741    positive regulation of epidermal growth factor-activated receptor activity    Any process that activates or increases the frequency, rate or extent of EGF-activated receptor activity.
    GO:1903378    positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway    Any process that activates or increases the frequency, rate or extent of oxidative stress-induced neuron intrinsic apoptotic signaling pathway.
    GO:1901800    positive regulation of proteasomal protein catabolic process    Any process that activates or increases the frequency, rate or extent of proteasomal protein catabolic process.
    GO:1903955    positive regulation of protein targeting to mitochondrion    Any process that activates or increases the frequency, rate or extent of protein targeting to mitochondrion.
    GO:0031398    positive regulation of protein ubiquitination    Any process that activates or increases the frequency, rate or extent of the addition of ubiquitin groups to a protein.
    GO:2000060    positive regulation of protein ubiquitination involved in ubiquitin-dependent protein catabolic process    Any process that activates or increases the frequency, rate or extent of protein ubiquitination involved in ubiquitin-dependent protein catabolic process.
    GO:0051443    positive regulation of ubiquitin-protein transferase activity    Any process that activates, maintains or increases the rate of ubiquitin transferase activity.
    GO:0000209    protein polyubiquitination    Addition of multiple ubiquitin groups to a protein, forming a ubiquitin chain.
    GO:0050821    protein stabilization    Any process involved in maintaining the structure and integrity of a protein and preventing it from degradation or aggregation.
    GO:0016567    protein ubiquitination    The process in which one or more ubiquitin groups are added to a protein.
    GO:1902806    regulation of cell cycle G1/S phase transition    Any process that modulates the frequency, rate or extent of cell cycle G1/S phase transition.
    GO:0010883    regulation of lipid storage    Any process that modulates the rate, frequency or extent of lipid storage. Lipid storage is the accumulation and maintenance in cells or tissues of lipids, compounds soluble in organic solvents but insoluble or sparingly soluble in aqueous solvents. Lipid reserves can be accumulated during early developmental stages for mobilization and utilization at later stages of development.
    GO:1903146    regulation of mitophagy    Any process that modulates the frequency, rate or extent of mitochondrion degradation (mitophagy).
    GO:0032880    regulation of protein localization    Any process that modulates the frequency, rate or extent of any process in which a protein is transported to, or maintained in, a specific location.
    GO:0007062    sister chromatid cohesion    The cell cycle process in which the sister chromatids of a replicated chromosome become tethered to each other.
    GO:0001944    vasculature development    The process whose specific outcome is the progression of the vasculature over time, from its formation to the mature structure. The vasculature is an interconnected tubular multi-tissue structure that contains fluid that is actively transported around the organism.
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
    GO:1990452    Parkin-FBXW7-Cul1 ubiquitin ligase complex    A ubiquitin ligase complex containing Parkin (PARK2), the F-box protein FBXW7 (also called SEL-10) and a cullin from the Cul1 subfamily; substrate specificity is conferred by the F-box protein.
    GO:0019005    SCF ubiquitin ligase complex    A ubiquitin ligase complex in which a cullin from the Cul1 subfamily and a RING domain protein form the catalytic core; substrate specificity is conferred by a Skp1 adaptor and an F-box protein. SCF complexes are involved in targeting proteins for degradation by the proteasome. The best characterized complexes are those from yeast and mammals (with core subunits named Cdc53/Cul1, Rbx1/Hrt1/Roc1).
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005730    nucleolus    A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0043234    protein complex    A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2ovp)
 
  Sites
(no "Sites" information available for 2ovp)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2ovp)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2ovp
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FBXW7_HUMAN | Q969H0
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  SKP1_HUMAN | P63208
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  FBXW7_HUMAN | Q969H0
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  SKP1_HUMAN | P63208
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        FBXW7_HUMAN | Q969H02ovq 2ovr 5ibk
        SKP1_HUMAN | P632081fqv 1fs1 1fs2 1ldk 1p22 2ass 2ast 2e31 2e32 2ovq 2ovr 3l2o 3wso 4i6j 5ibk 5jh5 5k35

(-) Related Entries Specified in the PDB File

2ovq 2ovr