2AST - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF SKP1-SKP2-CKS1 IN COMPLEX WITH A P27 PEPTIDE

Authors :   B. Hao, N. Zhang, B. A. Schulman, G. Wu, M. Pagano, N. P. Pavletich

Date :   24 Aug 05 (Deposition) - 18 Oct 05 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.30

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,B,C,D  (1x)
Biol. Unit 2: A,B,C,D  (2x)
Biol. Unit 3: A (2x),B (2x),C (2x),D (2x)

Keywords :   Scf-Substrate Complex, Lrr, Cell Cycle, Protein Turnover Complex, Ligase-Ligase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   B. Hao, N. Zheng, B. A. Schulman, G. Wu, J. J. Miller, M. Pagano, N. P. Pavletich
Structural Basis Of The Cks1-Dependent Recognition Of P27(Kip1) By The Scf(Skp2) Ubiquitin Ligase.
Mol. Cell V. 20 9 2005
PubMed-ID: 16209941 | Reference-DOI: 10.1016/J.MOLCEL.2005.09.003

Molecule 1 - S-PHASE KINASE-ASSOCIATED PROTEIN 1A
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PGEX4T1
	Expression System Strain	:	BL21 (DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Gene	:	SKP1A, EMC19, OCP2, SKP1, TCEB1L
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	CYCLIN A/CDK2-ASSOCIATED PROTEIN P19, P19A, P19SKP1, RNA POLYMERASE II ELONGATION FACTOR-LIKE PROTEIN, ORGAN OF CORTI PROTEIN 2, OCP-II PROTEIN, OCP-2, TRANSCRIPTION ELONGATION FACTOR B, SIII

Molecule 2 - S-PHASE KINASE-ASSOCIATED PROTEIN 2
	Chains	:	B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PGEX4T1
	Expression System Strain	:	BL21 (DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Gene	:	SKP2, FBXL1
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	F-BOX PROTEIN SKP2, CYCLIN A/CDK2-ASSOCIATED PROTEIN P45, P45SKP2, F-BOX/LRR-REPEAT PROTEIN 1

Molecule 3 - CYCLIN-DEPENDENT KINASES REGULATORY SUBUNIT 1
	Chains	:	C
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PGEX4T3
	Expression System Strain	:	BL21 (DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Gene	:	CKS1, CKS1B
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	CKS-1

Molecule 4 - CYCLIN-DEPENDENT KINASE INHIBITOR 1B
	Chains	:	D
	Engineered	:	YES
	Other Details	:	CHEMICAL SYNTHESIS, THIS SEQUENCE OCCURS NATURALLY IN HUMANS.
	Synonym	:	CYCLIN-DEPENDENT KINASE INHIBITOR P27, P27KIP1
	Synthetic	:	YES

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A	B	C	D
Biological Unit 2 (2x)	:	A	B	C	D
Biological Unit 3 (2x)	:	A (2x)	B (2x)	C (2x)	D (2x)

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 3)

No.	Name	Count	Type	Full Name
1	BEN	2	Ligand/Ion	BENZAMIDINE
2	TPO	1	Mod. Amino Acid	PHOSPHOTHREONINE

Biological Unit 1 (2, 3)

No.	Name	Count	Type	Full Name
1	BEN	2	Ligand/Ion	BENZAMIDINE
2	TPO	1	Mod. Amino Acid	PHOSPHOTHREONINE

Biological Unit 2 (2, 6)

No.	Name	Count	Type	Full Name
1	BEN	4	Ligand/Ion	BENZAMIDINE
2	TPO	2	Mod. Amino Acid	PHOSPHOTHREONINE

Biological Unit 3 (1, 2)

No.	Name	Count	Type	Full Name
1	BEN	2	Ligand/Ion	BENZAMIDINE
2	TPO	-1	Mod. Amino Acid	PHOSPHOTHREONINE

Asymmetric Unit (3, 3)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	PHE B:2169 , VAL B:2192 , HOH C:100 , HOH C:182 , HOH C:247 , MET C:3058 , ARG C:3070	BINDING SITE FOR RESIDUE BEN C 1001
2	AC2	SOFTWARE	HOH B:67 , HOH B:74 , HOH B:263 , ALA B:2227 , SER B:2230 , SER B:2254 , HIS C:3021 , HIS C:3060 , GLU C:3063 , ILE C:3066	BINDING SITE FOR RESIDUE BEN B 1002
3	AC3	SOFTWARE	HOH B:13 , ARG B:2294 , TYR B:2346 , ASP B:2347 , TYR C:3008 , ASP C:3010 , LYS C:3011 , ARG C:3020 , ARG C:3044 , GLN C:3049 , GLN C:3050 , SER C:3051 , GLN C:3052 , TRP C:3054	BINDING SITE FOR CHAIN D OF CYCLIN-DEPENDENT KINASE INHIBITOR 1B

(no "SS Bond" information available for 2AST)

(no "Cis Peptide Bond" information available for 2AST)

Asymmetric Unit (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_051999	F	14	L	SKP1_HUMAN	Polymorphism	11538034	A	F	1014	L

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_051999	F	14	L	SKP1_HUMAN	Polymorphism	11538034	A	F	1014	L

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (1, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_051999	F	14	L	SKP1_HUMAN	Polymorphism	11538034	A	F	1014	L

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (1, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_051999	F	14	L	SKP1_HUMAN	Polymorphism	11538034	A	F	1014	L

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CKS_1	PS00944	Cyclin-dependent kinases regulatory subunits signature 1.	CKS1_HUMAN	8-26	1	C:3008-3026
2	CKS_2	PS00945	Cyclin-dependent kinases regulatory subunits signature 2.	CKS1_HUMAN	60-70	1	C:3060-3070

Biological Unit 1 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CKS_1	PS00944	Cyclin-dependent kinases regulatory subunits signature 1.	CKS1_HUMAN	8-26	1	C:3008-3026
2	CKS_2	PS00945	Cyclin-dependent kinases regulatory subunits signature 2.	CKS1_HUMAN	60-70	1	C:3060-3070

Biological Unit 2 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CKS_1	PS00944	Cyclin-dependent kinases regulatory subunits signature 1.	CKS1_HUMAN	8-26	2	C:3008-3026
2	CKS_2	PS00945	Cyclin-dependent kinases regulatory subunits signature 2.	CKS1_HUMAN	60-70	2	C:3060-3070

Biological Unit 3 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CKS_1	PS00944	Cyclin-dependent kinases regulatory subunits signature 1.	CKS1_HUMAN	8-26	2	C:3008-3026
2	CKS_2	PS00945	Cyclin-dependent kinases regulatory subunits signature 2.	CKS1_HUMAN	60-70	2	C:3060-3070

Asymmetric Unit (17, 17)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.3a	ENST00000228872	3a	ENSE00000721808	chr12:12870397-12871248	852	CDN1B_HUMAN	1-159	159	0	-	-
1.4	ENST00000228872	4	ENSE00000822053	chr12:12871759-12871888	130	CDN1B_HUMAN	159-198	40	1	D:4181-4190	10
1.5c	ENST00000228872	5c	ENSE00000993687	chr12:12873970-12875305	1336	CDN1B_HUMAN	-	0	0	-	-

2.1b	ENST00000274255	1b	ENSE00001852758	chr5:36152169-36152372	204	SKP2_HUMAN	1-3	3	0	-	-
2.2a	ENST00000274255	2a	ENSE00001130153	chr5:36152873-36153144	272	SKP2_HUMAN	3-94	92	0	-	-
2.3	ENST00000274255	3	ENSE00001006180	chr5:36163747-36163858	112	SKP2_HUMAN	94-131	38	1	B:2095-2131	37
2.4	ENST00000274255	4	ENSE00001006177	chr5:36166621-36166764	144	SKP2_HUMAN	131-179	49	1	B:2131-2179	49
2.5	ENST00000274255	5	ENSE00001006179	chr5:36168415-36168549	135	SKP2_HUMAN	179-224	46	1	B:2179-2224	46
2.6b	ENST00000274255	6b	ENSE00001006176	chr5:36170446-36170544	99	SKP2_HUMAN	224-257	34	1	B:2224-2257	34
2.7	ENST00000274255	7	ENSE00002147593	chr5:36171705-36171835	131	SKP2_HUMAN	257-301	45	1	B:2257-2301	45
2.8	ENST00000274255	8	ENSE00000971194	chr5:36177067-36177118	52	SKP2_HUMAN	301-318	18	1	B:2301-2318	18
2.9	ENST00000274255	9	ENSE00000971195	chr5:36177287-36177394	108	SKP2_HUMAN	318-354	37	1	B:2318-2354	37
2.12c	ENST00000274255	12c	ENSE00001082238	chr5:36181920-36184421	2502	SKP2_HUMAN	354-424	71	1	B:2354-2419	66

3.1c	ENST00000308987	1c	ENSE00001200321	chr1:154947175-154947280	106	CKS1_HUMAN	1-20	20	1	C:3005-3020	16
3.4b	ENST00000308987	4b	ENSE00001200312	chr1:154950463-154950590	128	CKS1_HUMAN	20-63	44	1	C:3020-3063	44
3.5f	ENST00000308987	5f	ENSE00001848352	chr1:154951201-154951725	525	CKS1_HUMAN	63-79	17	1	C:3063-3073	11

4.2a	ENST00000353411	2a	ENSE00001169035	chr5:133512729-133512546	184	SKP1_HUMAN	-	0	0	-	-
4.5b	ENST00000353411	5b	ENSE00000763313	chr5:133509713-133509617	97	SKP1_HUMAN	1-33	33	1	A:1002-1033	32
4.7	ENST00000353411	7	ENSE00002156080	chr5:133502934-133502861	74	SKP1_HUMAN	33-57	25	1	A:1033-1051 (gaps)	25
4.8d	ENST00000353411	8d	ENSE00000763311	chr5:133496821-133496678	144	SKP1_HUMAN	58-105	48	1	A:1052-1105 (gaps)	54
4.9d	ENST00000353411	9d	ENSE00001328116	chr5:133494286-133494146	141	SKP1_HUMAN	106-152	47	1	A:1106-1152	47
4.9l	ENST00000353411	9l	ENSE00001291683	chr5:133493459-133492082	1378	SKP1_HUMAN	153-163	11	1	A:1153-1160	8

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:142
 aligned with SKP1_HUMAN | P63208 from UniProtKB/Swiss-Prot  Length:163

    Alignment length:159
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151         
          SKP1_HUMAN      2 PSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWC  160
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2astA00 A:1002-1160 Potassium Channe      l Kv1.1; Chain A                                                                                                      CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee.....eeeeehhhhhhhhhhhhhh......------.ee....hhhhhhhhhhhhhhh.....-----------....hhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhh........hhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------L-------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 4 (1) Exon 4.5b  PDB: A:1002-1033     ------------------------Exon 4.8d  PDB: A:1052-1105 (gaps)              Exon 4.9d  PDB: A:1106-1152 UniProt: 106-152   4.9l     Transcript 4 (1)
           Transcript 4 (2) -------------------------------Exon 4.7 UniProt: 33-57  ------------------------------------------------------------------------------------------------------- Transcript 4 (2)
                2ast A 1002 ASIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMD------PVPLPNVNAAILKKVIQWCTHHKDDPP-----------TDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWC 1160
                                  1011      1021      1031     |   -  |   1045      1055        |-         -|     1091      1101      1111      1121      1131      1141      1151         
                                                            1037   1038                      1064        1082

Chain B from PDB  Type:PROTEIN  Length:325
 aligned with SKP2_HUMAN | Q13309 from UniProtKB/Swiss-Prot  Length:424

    Alignment length:325
                                   104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414     
          SKP2_HUMAN     95 VSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQ  419
               SCOP domains --d2astb1 B:2097-2135 Skp2               d2astb2 B:2136-2419 Cyclin A/CDK2-associated p19, Skp2                                                                                                                                                                                                                                       SCOP domains
               CATH domains 2astB00 B:2095-2419 Ribonuclease Inhibitor                                                                                                                                                                                                                                                                                            CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhh..hhhhhhhh...hhhhhhhhh......eee......hhhhhhhhhhh...eee....ee..............eee....eehhhhhhhhhh......eee......hhhhhhhhh......eee.......hhhhhhhhhhhh....eee.......hhhhhhhhhhhh.....eee...hhhhhhhhhhhhhhhhh....eee.......hhhhhhhhhhh....eee.......hhhhhhhhhhh....eee........hhhhhhhhh...ee...........................ee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.3  PDB: B:2095-2131           -----------------------------------------------Exon 2.5  PDB: B:2179-2224 UniProt: 179-224   --------------------------------Exon 2.7  PDB: B:2257-2301 UniProt: 257-301  ----------------------------------------------------Exon 2.12c  PDB: B:2354-2419 UniProt: 354-424 [INCOMPLETE]         Transcript 2 (1)
           Transcript 2 (2) ------------------------------------Exon 2.4  PDB: B:2131-2179 UniProt: 131-179      --------------------------------------------Exon 2.6b  PDB: B:2224-2257       -------------------------------------------Exon 2.8          ----------------------------------------------------------------------------------------------------- Transcript 2 (2)
           Transcript 2 (3) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 2.9  PDB: B:2318-2354           ----------------------------------------------------------------- Transcript 2 (3)
                2ast B 2095 VSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQ 2419
                                  2104      2114      2124      2134      2144      2154      2164      2174      2184      2194      2204      2214      2224      2234      2244      2254      2264      2274      2284      2294      2304      2314      2324      2334      2344      2354      2364      2374      2384      2394      2404      2414

Chain C from PDB  Type:PROTEIN  Length:69
 aligned with CKS1_HUMAN | P61024 from UniProtKB/Swiss-Prot  Length:79

    Alignment length:69
                                    14        24        34        44        54        64         
          CKS1_HUMAN      5 QIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFRRPL   73
               SCOP domains d2astc_ C: CksHs1                                                     SCOP domains
               CATH domains 2astC00 C:3005-3073 Cyclin-Dependent Kinase Subunit Type 2            CATH domains
               Pfam domains --------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..ee...ee...eeeeeee.hhhhhh........hhhhhhhhh.......eeeee......eeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---CKS_1 UniProt: 8-26---------------------------------CKS_2      --- PROSITE
           Transcript 3 (1) Exon 3.1c       ------------------------------------------Exon 3.5f   Transcript 3 (1)
           Transcript 3 (2) ---------------Exon 3.4b  PDB: C:3020-3063 UniProt: 20-63  ---------- Transcript 3 (2)
                2ast C 3005 QIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFRRPL 3073
                                  3014      3024      3034      3044      3054      3064

Chain D from PDB  Type:PROTEIN  Length:10
 aligned with CDN1B_HUMAN | P46527 from UniProtKB/Swiss-Prot  Length:198

    Alignment length:10
                                   190
         CDN1B_HUMAN    181 AGSVEQTPKK  190
               SCOP domains ---------- SCOP domains
               CATH domains ---------- CATH domains
               Pfam domains ---------- Pfam domains
         Sec.struct. author .......... Sec.struct. author
                 SAPs(SNPs) ---------- SAPs(SNPs)
                    PROSITE ---------- PROSITE
               Transcript 1 Exon 1.4   Transcript 1
                2ast D 4181 AGSVEQtPKK 4190
                                  4190
                                  |   
                               4187-TPO

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "Pfam Domain" information available for 2AST)

Asymmetric Unit(hide GO term definitions)

Chain A (SKP1_HUMAN | P63208)

molecular function
	GO:0008013	beta-catenin binding	Interacting selectively and non-covalently with the beta subunit of the catenin complex.
	GO:0097602	cullin family protein binding	Interacting selectively and non-covalently with any member of the cullin family, hydrophobic proteins that act as scaffolds for ubiquitin ligases (E3).
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0061630	ubiquitin protein ligase activity	Catalysis of the transfer of ubiquitin to a substrate protein via the reaction X-ubiquitin + S -> X + S-ubiquitin, where X is either an E2 or E3 enzyme, the X-ubiquitin linkage is a thioester bond, and the S-ubiquitin linkage is an amide bond: an isopeptide bond between the C-terminal glycine of ubiquitin and the epsilon-amino group of lysine residues in the substrate or, in the linear extension of ubiquitin chains, a peptide bond the between the C-terminal glycine and N-terminal methionine of ubiquitin residues.
	GO:0004842	ubiquitin-protein transferase activity	Catalysis of the transfer of ubiquitin from one protein to another via the reaction X-Ub + Y --> Y-Ub + X, where both X-Ub and Y-Ub are covalent linkages.
biological process
	GO:0038095	Fc-epsilon receptor signaling pathway	A series of molecular signals initiated by the binding of the Fc portion of immunoglobulin E (IgE) to an Fc-epsilon receptor on the surface of a signal-receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription. The Fc portion of an immunoglobulin is its C-terminal constant region.
	GO:0000086	G2/M transition of mitotic cell cycle	The mitotic cell cycle transition by which a cell in G2 commits to M phase. The process begins when the kinase activity of M cyclin/CDK complex reaches a threshold high enough for the cell cycle to proceed. This is accomplished by activating a positive feedback loop that results in the accumulation of unphosphorylated and active M cyclin/CDK complex.
	GO:0038061	NIK/NF-kappaB signaling	The process in which a signal is passed on to downstream components within the cell through the NIK-dependent processing and activation of NF-KappaB. Begins with activation of the NF-KappaB-inducing kinase (NIK), which in turn phosphorylates and activates IkappaB kinase alpha (IKKalpha). IKKalpha phosphorylates the NF-Kappa B2 protein (p100) leading to p100 processing and release of an active NF-KappaB (p52).
	GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, with ubiquitin-protein ligation catalyzed by an SCF (Skp1/Cul1/F-box protein) complex, and mediated by the proteasome.
	GO:0050852	T cell receptor signaling pathway	A series of molecular signals initiated by the cross-linking of an antigen receptor on a T cell.
	GO:0016055	Wnt signaling pathway	The series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell and ending with a change in cell state.
	GO:0035518	histone H2A monoubiquitination	The modification of histone H2A by addition of a single ubiquitin group.
	GO:0051437	positive regulation of ubiquitin-protein ligase activity involved in regulation of mitotic cell cycle transition	Any process that activates, maintains or increases the rate of ubiquitin ligase activity that contributes to the regulation of the mitotic cell cycle phase transition.
	GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
	GO:0000209	protein polyubiquitination	Addition of multiple ubiquitin groups to a protein, forming a ubiquitin chain.
	GO:0016567	protein ubiquitination	The process in which one or more ubiquitin groups are added to a protein.
	GO:0002223	stimulatory C-type lectin receptor signaling pathway	Any series of molecular signals generated as a consequence of binding to a C-type lectin receptor capable of cellular activation.
	GO:0051403	stress-activated MAPK cascade	A series of molecular signals in which a stress-activated MAP kinase cascade relays one or more of the signals; MAP kinase cascades involve at least three protein kinase activities and culminate in the phosphorylation and activation of a MAP kinase.
	GO:0006511	ubiquitin-dependent protein catabolic process	The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
cellular component
	GO:0031467	Cul7-RING ubiquitin ligase complex	A ubiquitin ligase complex in which a cullin from the Cul7 subfamily and a RING domain protein form the catalytic core; substrate specificity is conferred by a Skp1 linker and an F-box protein.
	GO:0031519	PcG protein complex	A chromatin-associated multiprotein complex containing Polycomb Group proteins. In Drosophila, Polycomb group proteins are involved in the long-term maintenance of gene repression, and PcG protein complexes associate with Polycomb group response elements (PREs) in target genes to regulate higher-order chromatin structure.
	GO:0019005	SCF ubiquitin ligase complex	A ubiquitin ligase complex in which a cullin from the Cul1 subfamily and a RING domain protein form the catalytic core; substrate specificity is conferred by a Skp1 adaptor and an F-box protein. SCF complexes are involved in targeting proteins for degradation by the proteasome. The best characterized complexes are those from yeast and mammals (with core subunits named Cdc53/Cul1, Rbx1/Hrt1/Roc1).
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain B (SKP2_HUMAN | Q13309)

molecular function
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0061630	ubiquitin protein ligase activity	Catalysis of the transfer of ubiquitin to a substrate protein via the reaction X-ubiquitin + S -> X + S-ubiquitin, where X is either an E2 or E3 enzyme, the X-ubiquitin linkage is a thioester bond, and the S-ubiquitin linkage is an amide bond: an isopeptide bond between the C-terminal glycine of ubiquitin and the epsilon-amino group of lysine residues in the substrate or, in the linear extension of ubiquitin chains, a peptide bond the between the C-terminal glycine and N-terminal methionine of ubiquitin residues.
	GO:0004842	ubiquitin-protein transferase activity	Catalysis of the transfer of ubiquitin from one protein to another via the reaction X-Ub + Y --> Y-Ub + X, where both X-Ub and Y-Ub are covalent linkages.
biological process
	GO:0000082	G1/S transition of mitotic cell cycle	The mitotic cell cycle transition by which a cell in G1 commits to S phase. The process begins with the build up of G1 cyclin-dependent kinase (G1 CDK), resulting in the activation of transcription of G1 cyclins. The process ends with the positive feedback of the G1 cyclins on the G1 CDK which commits the cell to S phase, in which DNA replication is initiated.
	GO:0000086	G2/M transition of mitotic cell cycle	The mitotic cell cycle transition by which a cell in G2 commits to M phase. The process begins when the kinase activity of M cyclin/CDK complex reaches a threshold high enough for the cell cycle to proceed. This is accomplished by activating a positive feedback loop that results in the accumulation of unphosphorylated and active M cyclin/CDK complex.
	GO:0031145	anaphase-promoting complex-dependent catabolic process	The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, with ubiquitin-protein ligation catalyzed by the anaphase-promoting complex, and mediated by the proteasome.
	GO:0008283	cell proliferation	The multiplication or reproduction of cells, resulting in the expansion of a cell population.
	GO:0071460	cellular response to cell-matrix adhesion	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of cell-matrix adhesion.
	GO:0033148	positive regulation of intracellular estrogen receptor signaling pathway	Any process that activates or increases the frequency, rate or extent of the activity of an intracellular estrogen receptor signaling pathway.
	GO:1902916	positive regulation of protein polyubiquitination	Any process that activates or increases the frequency, rate or extent of protein polyubiquitination.
	GO:0048661	positive regulation of smooth muscle cell proliferation	Any process that activates or increases the rate or extent of smooth muscle cell proliferation.
	GO:0000209	protein polyubiquitination	Addition of multiple ubiquitin groups to a protein, forming a ubiquitin chain.
	GO:0016567	protein ubiquitination	The process in which one or more ubiquitin groups are added to a protein.
	GO:0042981	regulation of apoptotic process	Any process that modulates the occurrence or rate of cell death by apoptotic process.
	GO:0051726	regulation of cell cycle	Any process that modulates the rate or extent of progression through the cell cycle.
	GO:0006511	ubiquitin-dependent protein catabolic process	The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
cellular component
	GO:0019005	SCF ubiquitin ligase complex	A ubiquitin ligase complex in which a cullin from the Cul1 subfamily and a RING domain protein form the catalytic core; substrate specificity is conferred by a Skp1 adaptor and an F-box protein. SCF complexes are involved in targeting proteins for degradation by the proteasome. The best characterized complexes are those from yeast and mammals (with core subunits named Cdc53/Cul1, Rbx1/Hrt1/Roc1).
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005730	nucleolus	A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain C (CKS1_HUMAN | P61024)

molecular function
	GO:0016538	cyclin-dependent protein serine/threonine kinase regulator activity	Modulates the activity of a cyclin-dependent protein serine/threonine kinase, enzymes of the protein kinase family that are regulated through association with cyclins and other proteins.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0007049	cell cycle	The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
	GO:0051301	cell division	The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.
	GO:0008283	cell proliferation	The multiplication or reproduction of cells, resulting in the expansion of a cell population.
	GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity	Any process that modulates the frequency, rate or extent of cyclin-dependent protein serine/threonine kinase activity.
cellular component
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.

Chain D (CDN1B_HUMAN | P46527)

molecular function
	GO:0030544	Hsp70 protein binding	Interacting selectively and non-covalently with Hsp70 proteins, any of a group of heat shock proteins around 70kDa in size.
	GO:0051087	chaperone binding	Interacting selectively and non-covalently with a chaperone protein, a class of proteins that bind to nascent or unfolded polypeptides and ensure correct folding or transport.
	GO:0004861	cyclin-dependent protein serine/threonine kinase inhibitor activity	Stops, prevents or reduces the activity of a cyclin-dependent protein serine/threonine kinase.
	GO:0008656	cysteine-type endopeptidase activator activity involved in apoptotic process	Increases the rate of proteolysis catalyzed by a cysteine-type endopeptidase involved in the apoptotic process.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0032403	protein complex binding	Interacting selectively and non-covalently with any protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004860	protein kinase inhibitor activity	Stops, prevents or reduces the activity of a protein kinase, an enzyme which phosphorylates a protein.
	GO:0019903	protein phosphatase binding	Interacting selectively and non-covalently with any protein phosphatase.
	GO:0005072	transforming growth factor beta receptor, cytoplasmic mediator activity	Activity of any of the molecules that transmit the signal from a TGF-beta receptor through the cytoplasm to the nucleus.
biological process
	GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	A cascade of processes induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, in response to the detection of DNA damage and resulting in the stopping or reduction in rate of the cell cycle.
	GO:0000082	G1/S transition of mitotic cell cycle	The mitotic cell cycle transition by which a cell in G1 commits to S phase. The process begins with the build up of G1 cyclin-dependent kinase (G1 CDK), resulting in the activation of transcription of G1 cyclins. The process ends with the positive feedback of the G1 cyclins on the G1 CDK which commits the cell to S phase, in which DNA replication is initiated.
	GO:0007219	Notch signaling pathway	A series of molecular signals initiated by the binding of an extracellular ligand to the receptor Notch on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	Any process that initiates the activity of the inactive enzyme cysteine-type endopeptidase in the context of an apoptotic process.
	GO:0048102	autophagic cell death	A form of programmed cell death that is accompanied by the formation of autophagosomes. Autophagic cell death is characterized by lack of chromatin condensation and massive vacuolization of the cytoplasm, with little or no uptake by phagocytic cells.
	GO:0007049	cell cycle	The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
	GO:0007050	cell cycle arrest	A regulatory process that halts progression through the cell cycle during one of the normal phases (G1, S, G2, M).
	GO:0008219	cell death	Any biological process that results in permanent cessation of all vital functions of a cell. A cell should be considered dead when any one of the following molecular or morphological criteria is met: (1) the cell has lost the integrity of its plasma membrane; (2) the cell, including its nucleus, has undergone complete fragmentation into discrete bodies (frequently referred to as apoptotic bodies). The cell corpse (or its fragments) may be engulfed by an adjacent cell in vivo, but engulfment of whole cells should not be considered a strict criteria to define cell death as, under some circumstances, live engulfed cells can be released from phagosomes (see PMID:18045538).
	GO:0071236	cellular response to antibiotic	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an antibiotic stimulus. An antibiotic is a chemical substance produced by a microorganism which has the capacity to inhibit the growth of or to kill other microorganisms.
	GO:0071285	cellular response to lithium ion	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lithium (Li+) ion stimulus.
	GO:0071407	cellular response to organic cyclic compound	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic cyclic compound stimulus.
	GO:0048839	inner ear development	The process whose specific outcome is the progression of the inner ear over time, from its formation to the mature structure.
	GO:0071850	mitotic cell cycle arrest	The process in which the mitotic cell cycle is halted during one of the normal phases (G1, S, G2, M).
	GO:0043066	negative regulation of apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
	GO:0030308	negative regulation of cell growth	Any process that stops, prevents, or reduces the frequency, rate, extent or direction of cell growth.
	GO:0008285	negative regulation of cell proliferation	Any process that stops, prevents or reduces the rate or extent of cell proliferation.
	GO:0051271	negative regulation of cellular component movement	Any process that stops, prevents, or reduces the frequency, rate or extent of the movement of a cellular component.
	GO:0045736	negative regulation of cyclin-dependent protein serine/threonine kinase activity	Any process that stops, prevents, or reduces the frequency, rate or extent of cyclin-dependent protein serine/threonine kinase activity.
	GO:0050680	negative regulation of epithelial cell proliferation	Any process that stops, prevents or reduces the rate or extent of epithelial cell proliferation.
	GO:0060770	negative regulation of epithelial cell proliferation involved in prostate gland development	Any process that decreases the rate, frequency or extent of epithelial cell proliferation that contributes to the progression of the prostate gland over time.
	GO:0033673	negative regulation of kinase activity	Any process that stops, prevents, or reduces the frequency, rate or extent of kinase activity, the catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
	GO:0045930	negative regulation of mitotic cell cycle	Any process that stops, prevents or reduces the rate or extent of progression through the mitotic cell cycle.
	GO:0042326	negative regulation of phosphorylation	Any process that stops, prevents or decreases the rate of addition of phosphate groups to a molecule.
	GO:0045892	negative regulation of transcription, DNA-templated	Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
	GO:1904706	negative regulation of vascular smooth muscle cell proliferation	Any process that stops, prevents or reduces the frequency, rate or extent of vascular smooth muscle cell proliferation.
	GO:0045787	positive regulation of cell cycle	Any process that activates or increases the rate or extent of progression through the cell cycle.
	GO:0010942	positive regulation of cell death	Any process that increases the rate or frequency of cell death. Cell death is the specific activation or halting of processes within a cell so that its vital functions markedly cease, rather than simply deteriorating gradually over time, which culminates in cell death.
	GO:0008284	positive regulation of cell proliferation	Any process that activates or increases the rate or extent of cell proliferation.
	GO:0045737	positive regulation of cyclin-dependent protein serine/threonine kinase activity	Any process that activates or increases the frequency, rate or extent of CDK activity.
	GO:0031116	positive regulation of microtubule polymerization	Any process that activates or increases the frequency, rate or extent of microtubule polymerization.
	GO:0045732	positive regulation of protein catabolic process	Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the breakdown of a protein by the destruction of the native, active configuration, with or without the hydrolysis of peptide bonds.
	GO:0006813	potassium ion transport	The directed movement of potassium ions (K+) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0042127	regulation of cell proliferation	Any process that modulates the frequency, rate or extent of cell proliferation.
	GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity	Any process that modulates the frequency, rate or extent of cyclin-dependent protein serine/threonine kinase activity.
	GO:0043200	response to amino acid	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an amino acid stimulus. An amino acid is a carboxylic acids containing one or more amino groups.
	GO:0046686	response to cadmium ion	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cadmium (Cd) ion stimulus.
	GO:0042493	response to drug	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
	GO:0032355	response to estradiol	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of stimulus by estradiol, a C18 steroid hormone hydroxylated at C3 and C17 that acts as a potent estrogen.
	GO:0009749	response to glucose	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a glucose stimulus.
	GO:0001666	response to hypoxia	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating lowered oxygen tension. Hypoxia, defined as a decline in O2 levels below normoxic levels of 20.8 - 20.95%, results in metabolic adaptation at both the cellular and organismal level.
	GO:0014070	response to organic cyclic compound	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic cyclic compound stimulus.
	GO:0043434	response to peptide hormone	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a peptide hormone stimulus. A peptide hormone is any of a class of peptides that are secreted into the blood stream and have endocrine functions in living animals.
	GO:0007605	sensory perception of sound	The series of events required for an organism to receive an auditory stimulus, convert it to a molecular signal, and recognize and characterize the signal. Sonic stimuli are detected in the form of vibrations and are processed to form a sound.
cellular component
	GO:0031464	Cul4A-RING E3 ubiquitin ligase complex	A ubiquitin ligase complex in which a cullin from the Cul4A subfamily and a RING domain protein form the catalytic core; substrate specificity is conferred by an adaptor protein.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005768	endosome	A vacuole to which materials ingested by endocytosis are delivered.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		BEN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		TPO	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2ast)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2ast
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CDN1B_HUMAN \| P46527
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	CKS1_HUMAN \| P61024
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	SKP1_HUMAN \| P63208
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	SKP2_HUMAN \| Q13309
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CDN1B_HUMAN \| P46527
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	CKS1_HUMAN \| P61024
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	SKP1_HUMAN \| P63208
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	SKP2_HUMAN \| Q13309
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	CDN1B_HUMAN \| P46527	:	1h27 1jsu 5uq3
	CKS1_HUMAN \| P61024	:	1buh 1dks 1dkt 2ass 4yc6
	SKP1_HUMAN \| P63208	:	1fqv 1fs1 1fs2 1ldk 1p22 2ass 2e31 2e32 2ovp 2ovq 2ovr 3l2o 3wso 4i6j 5ibk 5jh5 5k35
	SKP2_HUMAN \| Q13309	:	1fqv 1fs1 1fs2 1ldk 2ass

1fqv	CRYSTAL STRUCTURE OF SKP1-SKP2
2ass	CRYSTAL STRUCTURE OF THE SKP1-SKP2-CKS1 COMPLEX

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 3)

Sites (3, 3)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 1)

PROSITE Motifs (2, 2)

Exons (17, 17)

Sequences/Alignments

Classification and Annotation

SCOP Domains (3, 3)

CATH Domains (3, 3)

Pfam Domains (0, 0)

Gene Ontology (93, 116)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File