Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF TRANSHYDROGENASE (DI.NAD+)2(DIII.H2NADPH)1 ASYMMETRIC COMPLEX
 
Authors :  T. Bhakta, Jackson J. B.
Date :  26 Jan 07  (Deposition) - 13 Mar 07  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.32
Chains :  Asym./Biol. Unit :  A,B,C
Keywords :  Rossmann Fold; Nad(H)-Binding Site; Nadp(H)-Binding Site, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  T. Bhakta, S. J. Whitehead, J. S. Snaith, T. R. Dafforn, J. Wilkie, S. Rajesh, S. A. White, J. B. Jackson
Structures Of The Di(2)Diii(1) Complex Of Proton-Translocating Transhydrogenase With Bound, Inactive Analogues Of Nadh And Nadph Reveal Active Site Geometries
Biochemistry V. 46 3304 2007
PubMed-ID: 17323922  |  Reference-DOI: 10.1021/BI061843R

(-) Compounds

Molecule 1 - NAD(P) TRANSHYDROGENASE SUBUNIT ALPHA PART 1
    Chains: A, B
    EC Number: 1.6.1.2
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PCD1
    Expression System Strain: C600
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: PNTAA, NNTA1
    Organism Scientific: RHODOSPIRILLUM RUBRUM
    Organism Taxid: 1085
    Synonym: PYRIDINE NUCLEOTIDE TRANSHYDROGENASE SUBUNIT ALPHA 1
 
Molecule 2 - NAD(P) TRANSHYDROGENASE SUBUNIT BETA
    Chains: C
    EC Number: 1.6.1.2
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PNIC2
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Fragment: RESIDUES 262-464
    Gene: PNTB, NNTB
    Organism Scientific: RHODOSPIRILLUM RUBRUM
    Organism Taxid: 1085
    Synonym: PYRIDINE NUCLEOTIDE TRANSHYDROGENASE SUBUNIT BETA

 Structural Features

(-) Chains, Units

  123
Asymmetric/Biological Unit : ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 4)

Asymmetric/Biological Unit (3, 4)
No.NameCountTypeFull Name
1GOL1Ligand/IonGLYCEROL
2NAD2Ligand/IonNICOTINAMIDE-ADENINE-DINUCLEOTIDE
3TXP1Ligand/Ion1,4,5,6-TETRAHYDRONICOTINAMIDE ADENINE DINUCLEOTIDEPHOSPHATE

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLN B:132 , GLY C:54 , TYR C:55 , GLY C:56 , VAL C:59 , ALA C:60 , VAL C:87 , ALA C:88 , GLY C:89 , ARG C:90 , MET C:91 , PRO C:92 , GLY C:129 , ALA C:130 , ASN C:131 , ASP C:132 , VAL C:133 , LYS C:164 , ARG C:165 , SER C:166 , ALA C:168 , SER C:169 , GLY C:170 , TYR C:171 , ASP C:190 , ALA C:191BINDING SITE FOR RESIDUE TXP C 400
2AC2SOFTWAREARG A:127 , ILE A:128 , ASP A:135 , GLY A:181 , VAL A:182 , ASP A:202 , VAL A:203 , ARG A:204 , GLY A:234 , ALA A:236 , GLN A:247 , THR A:264 , ALA A:265 , LEU A:266 , PRO A:273 , LEU A:275 , HOH A:517 , HOH A:519 , HOH A:525BINDING SITE FOR RESIDUE NAD A 500
3AC3SOFTWAREARG B:127 , GLY B:179 , GLY B:181 , VAL B:182 , ASP B:202 , VAL B:203 , ARG B:204 , ALA B:265 , LEU B:266 , PRO B:273 , LEU B:275BINDING SITE FOR RESIDUE NAD B 600
4AC4SOFTWAREARG B:15 , GLN B:75 , HIS B:99 , GLU B:296 , ASN B:322BINDING SITE FOR RESIDUE GOL B 700

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2OOR)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Met B:1 -Lys B:2
2Asn C:45 -Ala C:46

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2OOR)

(-) PROSITE Motifs  (2, 4)

Asymmetric/Biological Unit (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ALADH_PNT_1PS00836 Alanine dehydrogenase & pyridine nucleotide transhydrogenase signature 1.PNTAA_RHORT4-30
 
  2A:4-30
B:4-30
PNTAA_RHORU4-30
 
  2A:4-30
B:4-30
2ALADH_PNT_2PS00837 Alanine dehydrogenase & pyridine nucleotide transhydrogenase signature 2.PNTAA_RHORT177-202
 
  2A:177-202
B:177-202
PNTAA_RHORU177-202
 
  2A:177-202
B:177-202

(-) Exons   (0, 0)

(no "Exon" information available for 2OOR)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:378
 aligned with PNTAA_RHORT | Q2RSB2 from UniProtKB/Swiss-Prot  Length:384

    Alignment length:378
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370        
          PNTAA_RHORT     1 MKIAIPKERRPGEDRVAISPEVVKKLVGLGFEVIVEQGAGVGASITDDALTAAGATIASTAAQALSQADVVWKVQRPMTAEEGTDEVALIKEGAVLMCHLGALTNRPVVEALTKRKITAYAMELMPRISRAQSMDILSSQSNLAGYRAVIDGAYEFARAFPMMMTAAGTVPPARVLVFGVGVAGLQAIATAKRLGAVVMATDVRAATKEQVESLGGKFITVDDEAMKTAETAGGYAKEMGEEFRKKQAEAVLKELVKTDIAITTALIPGKPAPVLITEEMVTKMKPGSVIIDLAVEAGGNCPLSEPGKIVVKHGVKIVGHTNVPSRVAADASPLFAKNLLNFLTPHVDKDTKTLVMKLEDETVSGTCVTRDGAIVHPA 378
               SCOP domains d2oora2 A:1-143,A:327-378 Nicotinamide nucleotide transhydrogenase dI component                                                                d2oora1 A:144-326 Nicotinamide nucleotide transhydrogenase dI component                                                                                                                d2oora2 A:1-143,A:327-378                            SCOP domains
               CATH domains -2oorA01 A:2-143,A:327-370  [code=3.40.50.1770, no name defined]                                                                               2oorA02 A:144-326 NAD(P)-binding Rossmann-like Domain                                                                                                                                  2oorA01 A:2-143,A:327-370                   -------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeee.............hhhhhhhhhhhh.eeeee.........hhhhhhhhh.eee.hhhhhhh...eeeeee...................eeeee......hhhhhhhhhh..eeee.hhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.................eeeee..hhhhhhhhhhhhhh..eeeee....hhhhhhhhh..ee...hhhhhh............hhhhhhhhhhhhhhhhh...eeee.............hhhhhhh.....eeee.hhhhh.........eeeee..eeeee..hhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhheee......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ---ALADH_PNT_1  PDB: A:4-30   --------------------------------------------------------------------------------------------------------------------------------------------------ALADH_PNT_2  PDB: A:177-20-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2oor A   1 MKIAIPKERRPGEDRVAISPEVVKKLVGLGFEVIVEQGAGVGASITDDALTAAGATIASTAAQALSQADVVWKVQRPMTAEEGTDEVALIKEGAVLMCHLGALTNRPVVEALTKRKITAYAMELMPRISRAQSMDILSSQSNLAGYRAVIDGAYEFARAFPMMMTAAGTVPPARVLVFGVGVAGLQAIATAKRLGAVVMATDVRAATKEQVESLGGKFITVDDEAMKTAETAGGYAKEMGEEFRKKQAEAVLKELVKTDIAITTALIPGKPAPVLITEEMVTKMKPGSVIIDLAVEAGGNCPLSEPGKIVVKHGVKIVGHTNVPSRVAADASPLFAKNLLNFLTPHVDKDTKTLVMKLEDETVSGTCVTRDGAIVHPA 378
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370        

Chain A from PDB  Type:PROTEIN  Length:378
 aligned with PNTAA_RHORU | P0C186 from UniProtKB/Swiss-Prot  Length:384

    Alignment length:378
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370        
          PNTAA_RHORU     1 MKIAIPKERRPGEDRVAISPEVVKKLVGLGFEVIVEQGAGVGASITDDALTAAGATIASTAAQALSQADVVWKVQRPMTAEEGTDEVALIKEGAVLMCHLGALTNRPVVEALTKRKITAYAMELMPRISRAQSMDILSSQSNLAGYRAVIDGAYEFARAFPMMMTAAGTVPPARVLVFGVGVAGLQAIATAKRLGAVVMATDVRAATKEQVESLGGKFITVDDEAMKTAETAGGYAKEMGEEFRKKQAEAVLKELVKTDIAITTALIPGKPAPVLITEEMVTKMKPGSVIIDLAVEAGGNCPLSEPGKIVVKHGVKIVGHTNVPSRVAADASPLFAKNLLNFLTPHVDKDTKTLVMKLEDETVSGTCVTRDGAIVHPA 378
               SCOP domains d2oora2 A:1-143,A:327-378 Nicotinamide nucleotide transhydrogenase dI component                                                                d2oora1 A:144-326 Nicotinamide nucleotide transhydrogenase dI component                                                                                                                d2oora2 A:1-143,A:327-378                            SCOP domains
               CATH domains -2oorA01 A:2-143,A:327-370  [code=3.40.50.1770, no name defined]                                                                               2oorA02 A:144-326 NAD(P)-binding Rossmann-like Domain                                                                                                                                  2oorA01 A:2-143,A:327-370                   -------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeee.............hhhhhhhhhhhh.eeeee.........hhhhhhhhh.eee.hhhhhhh...eeeeee...................eeeee......hhhhhhhhhh..eeee.hhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.................eeeee..hhhhhhhhhhhhhh..eeeee....hhhhhhhhh..ee...hhhhhh............hhhhhhhhhhhhhhhhh...eeee.............hhhhhhh.....eeee.hhhhh.........eeeee..eeeee..hhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhheee......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ---ALADH_PNT_1  PDB: A:4-30   --------------------------------------------------------------------------------------------------------------------------------------------------ALADH_PNT_2  PDB: A:177-20-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2oor A   1 MKIAIPKERRPGEDRVAISPEVVKKLVGLGFEVIVEQGAGVGASITDDALTAAGATIASTAAQALSQADVVWKVQRPMTAEEGTDEVALIKEGAVLMCHLGALTNRPVVEALTKRKITAYAMELMPRISRAQSMDILSSQSNLAGYRAVIDGAYEFARAFPMMMTAAGTVPPARVLVFGVGVAGLQAIATAKRLGAVVMATDVRAATKEQVESLGGKFITVDDEAMKTAETAGGYAKEMGEEFRKKQAEAVLKELVKTDIAITTALIPGKPAPVLITEEMVTKMKPGSVIIDLAVEAGGNCPLSEPGKIVVKHGVKIVGHTNVPSRVAADASPLFAKNLLNFLTPHVDKDTKTLVMKLEDETVSGTCVTRDGAIVHPA 378
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370        

Chain B from PDB  Type:PROTEIN  Length:364
 aligned with PNTAA_RHORT | Q2RSB2 from UniProtKB/Swiss-Prot  Length:384

    Alignment length:381
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380 
          PNTAA_RHORT     1 MKIAIPKERRPGEDRVAISPEVVKKLVGLGFEVIVEQGAGVGASITDDALTAAGATIASTAAQALSQADVVWKVQRPMTAEEGTDEVALIKEGAVLMCHLGALTNRPVVEALTKRKITAYAMELMPRISRAQSMDILSSQSNLAGYRAVIDGAYEFARAFPMMMTAAGTVPPARVLVFGVGVAGLQAIATAKRLGAVVMATDVRAATKEQVESLGGKFITVDDEAMKTAETAGGYAKEMGEEFRKKQAEAVLKELVKTDIAITTALIPGKPAPVLITEEMVTKMKPGSVIIDLAVEAGGNCPLSEPGKIVVKHGVKIVGHTNVPSRVAADASPLFAKNLLNFLTPHVDKDTKTLVMKLEDETVSGTCVTRDGAIVHPALTG 381
               SCOP domains d2oorb2 B:1-143,B:327-381 Nicotinamide nucleotide transhydrogenase dI component                                                                d2oorb1 B:144-326 Nicotinamide nucleotide transhydrogenase dI component                                                                                                                d2oorb2 B:1-143,B:327-381                               SCOP domains
               CATH domains -2oorB01 B:2-143,B:327-370  [code=3.40.50.1770, no name defined]                                                                               2oorB02 B:144-326 NAD(P)-binding Rossmann-like Domain                                                                                                                                  2oorB01 B:2-143,B:327-370                   ----------- CATH domains
           Pfam domains (1) ---AlaDh_PNT_N-2oorB01 B:4-144                                                                                                                  --------AlaDh_PNT_C-2oorB03 B:153-319                                                                                                                                          -------------------------------------------------------------- Pfam domains (1)
           Pfam domains (2) ---AlaDh_PNT_N-2oorB02 B:4-144                                                                                                                  --------AlaDh_PNT_C-2oorB04 B:153-319                                                                                                                                          -------------------------------------------------------------- Pfam domains (2)
         Sec.struct. author .eeee.............hhhhhhhhhhh..eeeee.........hhhhhhhhh.eee.hhhhhhhh..eeeeee...hhhhh..hhhhh....eeeee.....hhhhhhhhhhh..eeee.hhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh......eee..eee...eeeee..hhhhhhhhhhhhhh..eeeee....hhhhhhhh...ee....-----------------..hhhhhhhhhhhhhhhh..eeee.............hhhhhhh.....eeee.hhhhh.........eeeee..eeeee..hhhhhhhhhhhhhhhhhhhhhhh..eehhhhee.....hhhhhhheeee..ee....... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---ALADH_PNT_1  PDB: B:4-30   --------------------------------------------------------------------------------------------------------------------------------------------------ALADH_PNT_2  PDB: B:177-20----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2oor B   1 MKIAIPKERRPGEDRVAISPEVVKKLVGLGFEVIVEQGAGVGASITDDALTAAGATIASTAAQALSQADVVWKVQRPMTAEEGTDEVALIKEGAVLMCHLGALTNRPVVEALTKRKITAYAMELMPRISRAQSMDILSSQSNLAGYRAVIDGAYEFARAFPMMMTAAGTVPPARVLVFGVGVAGLQAIATAKRLGAVVMATDVRAATKEQVESLGGKFITVD-----------------GEEFRKKQAEAVLKELVKTDIAITTALIPGKPAPVLITEEMVTKMKPGSVIIDLAVEAGGNCPLSEPGKIVVKHGVKIVGHTNVPSRVAADASPLFAKNLLNFLTPHVDKDTKTLVMKLEDETVSGTCVTRDGAIVHPALTG 381
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220 |       -       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380 
                                                                                                                                                                                                                                                       222               240                                                                                                                                             

Chain B from PDB  Type:PROTEIN  Length:364
 aligned with PNTAA_RHORU | P0C186 from UniProtKB/Swiss-Prot  Length:384

    Alignment length:381
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380 
          PNTAA_RHORU     1 MKIAIPKERRPGEDRVAISPEVVKKLVGLGFEVIVEQGAGVGASITDDALTAAGATIASTAAQALSQADVVWKVQRPMTAEEGTDEVALIKEGAVLMCHLGALTNRPVVEALTKRKITAYAMELMPRISRAQSMDILSSQSNLAGYRAVIDGAYEFARAFPMMMTAAGTVPPARVLVFGVGVAGLQAIATAKRLGAVVMATDVRAATKEQVESLGGKFITVDDEAMKTAETAGGYAKEMGEEFRKKQAEAVLKELVKTDIAITTALIPGKPAPVLITEEMVTKMKPGSVIIDLAVEAGGNCPLSEPGKIVVKHGVKIVGHTNVPSRVAADASPLFAKNLLNFLTPHVDKDTKTLVMKLEDETVSGTCVTRDGAIVHPALTG 381
               SCOP domains d2oorb2 B:1-143,B:327-381 Nicotinamide nucleotide transhydrogenase dI component                                                                d2oorb1 B:144-326 Nicotinamide nucleotide transhydrogenase dI component                                                                                                                d2oorb2 B:1-143,B:327-381                               SCOP domains
               CATH domains -2oorB01 B:2-143,B:327-370  [code=3.40.50.1770, no name defined]                                                                               2oorB02 B:144-326 NAD(P)-binding Rossmann-like Domain                                                                                                                                  2oorB01 B:2-143,B:327-370                   ----------- CATH domains
           Pfam domains (1) ---AlaDh_PNT_N-2oorB01 B:4-144                                                                                                                  --------AlaDh_PNT_C-2oorB03 B:153-319                                                                                                                                          -------------------------------------------------------------- Pfam domains (1)
           Pfam domains (2) ---AlaDh_PNT_N-2oorB02 B:4-144                                                                                                                  --------AlaDh_PNT_C-2oorB04 B:153-319                                                                                                                                          -------------------------------------------------------------- Pfam domains (2)
         Sec.struct. author .eeee.............hhhhhhhhhhh..eeeee.........hhhhhhhhh.eee.hhhhhhhh..eeeeee...hhhhh..hhhhh....eeeee.....hhhhhhhhhhh..eeee.hhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh......eee..eee...eeeee..hhhhhhhhhhhhhh..eeeee....hhhhhhhh...ee....-----------------..hhhhhhhhhhhhhhhh..eeee.............hhhhhhh.....eeee.hhhhh.........eeeee..eeeee..hhhhhhhhhhhhhhhhhhhhhhh..eehhhhee.....hhhhhhheeee..ee....... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---ALADH_PNT_1  PDB: B:4-30   --------------------------------------------------------------------------------------------------------------------------------------------------ALADH_PNT_2  PDB: B:177-20----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2oor B   1 MKIAIPKERRPGEDRVAISPEVVKKLVGLGFEVIVEQGAGVGASITDDALTAAGATIASTAAQALSQADVVWKVQRPMTAEEGTDEVALIKEGAVLMCHLGALTNRPVVEALTKRKITAYAMELMPRISRAQSMDILSSQSNLAGYRAVIDGAYEFARAFPMMMTAAGTVPPARVLVFGVGVAGLQAIATAKRLGAVVMATDVRAATKEQVESLGGKFITVD-----------------GEEFRKKQAEAVLKELVKTDIAITTALIPGKPAPVLITEEMVTKMKPGSVIIDLAVEAGGNCPLSEPGKIVVKHGVKIVGHTNVPSRVAADASPLFAKNLLNFLTPHVDKDTKTLVMKLEDETVSGTCVTRDGAIVHPALTG 381
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220 |       -       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380 
                                                                                                                                                                                                                                                       222               240                                                                                                                                             

Chain C from PDB  Type:PROTEIN  Length:173
 aligned with PNTB_RHORU | P0C188 from UniProtKB/Swiss-Prot  Length:464

    Alignment length:173
                                   300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460   
           PNTB_RHORU   291 SVKAGSAEDAAFIMKNASKVIIVPGYGMAVAQAQHALREMADVLKKEGVEVSYAIHPVAGRMPGHMNVLLAEANVPYDEVFELEEINSSFQTADVAFVIGANDVTNPAAKTDPSSPIYGMPILDVEKAGTVLFIKRSMASGYAGVENELFFRNNTMMLFGDAKKMTEQIVQAM 463
               SCOP domains d2oorc_ C: Transhydrogenase domain III (dIII)                                                                                                                                 SCOP domains
               CATH domains 2oorC00 C:30-202 TPP-binding domain                                                                                                                                           CATH domains
               Pfam domains PNTB-2oorC01 C:30-202                                                                                                                                                         Pfam domains
         Sec.struct. author ...eehhhhhhhhhhh..eeeeeehhhhhhhhhhhhhhhhhhhhhhhh.eeeeee........hhhhhhhhhh..hhh.eeehhhhhhhhhh..eeeee..hhhhhhhhh.............hhhhh.eeeeee...........hhhhhh..eeeee.hhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2oor C  30 SVKAGSAEDAAFIMKNASKVIIVPGYGMAVAQAQHALREMADVLKKEGVEVSYAIHPVAGRMPGHMNVLLAEANVPYDEVFELEEINSSFQTADVAFVIGANDVTNPAAKTDPSSPIYGMPILDVEKAGTVLFIKRSMASGYAGVENELFFRNNTMMLFGDAKKMTEQIVQAM 202
                                    39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (3, 5)

Asymmetric/Biological Unit

(-) CATH Domains  (3, 5)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (3, 5)

Asymmetric/Biological Unit
(-)
Clan: FAD_DHS (82)

(-) Gene Ontology  (16, 27)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (PNTAA_RHORU | P0C186)
molecular function
    GO:0051287    NAD binding    Interacting selectively and non-covalently with nicotinamide adenine dinucleotide, a coenzyme involved in many redox and biosynthetic reactions; binding may be to either the oxidized form, NAD+, or the reduced form, NADH.
    GO:0008750    NAD(P)+ transhydrogenase (AB-specific) activity    Catalysis of the reaction: NADPH + H+ + NAD+ = NADP+ + NADH + H+. The reaction is A-specific (i.e. the pro-R hydrogen is transferred from the 4-position of reduced nicotinamide cofactor) with respect to NAD+ and B-specific (i.e. the pro-S hydrogen is transferred) with respect to NADP+.
    GO:0070403    NAD+ binding    Interacting selectively and non-covalently with the oxidized form, NAD, of nicotinamide adenine dinucleotide, a coenzyme involved in many redox and biosynthetic reactions.
    GO:0070404    NADH binding    Interacting selectively and non-covalently with the reduced form, NADH, of nicotinamide adenine dinucleotide, a coenzyme involved in many redox and biosynthetic reactions.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
    GO:0006740    NADPH regeneration    A metabolic process that generates a pool of NADPH by the reduction of NADP+.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

Chain A,B   (PNTAA_RHORT | Q2RSB2)
molecular function
    GO:0051287    NAD binding    Interacting selectively and non-covalently with nicotinamide adenine dinucleotide, a coenzyme involved in many redox and biosynthetic reactions; binding may be to either the oxidized form, NAD+, or the reduced form, NADH.
    GO:0008750    NAD(P)+ transhydrogenase (AB-specific) activity    Catalysis of the reaction: NADPH + H+ + NAD+ = NADP+ + NADH + H+. The reaction is A-specific (i.e. the pro-R hydrogen is transferred from the 4-position of reduced nicotinamide cofactor) with respect to NAD+ and B-specific (i.e. the pro-S hydrogen is transferred) with respect to NADP+.
    GO:0003957    NAD(P)+ transhydrogenase (B-specific) activity    Catalysis of the reaction: NADPH + H+ + NAD+ = NADP+ + NADH + H+, driving the transfer of a solute or solutes from one side of a membrane to the other. In the course of the reaction (left to right) one H atom is transferred from inside the cell to outside. The reaction is B-specific (i.e. the pro-S hydrogen is transferred from the 4-position of reduced nicotinamide cofactor) with respect to both NAD+ and NADP+.
    GO:0070403    NAD+ binding    Interacting selectively and non-covalently with the oxidized form, NAD, of nicotinamide adenine dinucleotide, a coenzyme involved in many redox and biosynthetic reactions.
    GO:0070404    NADH binding    Interacting selectively and non-covalently with the reduced form, NADH, of nicotinamide adenine dinucleotide, a coenzyme involved in many redox and biosynthetic reactions.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0046983    protein dimerization activity    The formation of a protein dimer, a macromolecular structure consists of two noncovalently associated identical or nonidentical subunits.
biological process
    GO:0006740    NADPH regeneration    A metabolic process that generates a pool of NADPH by the reduction of NADP+.
    GO:1902600    hydrogen ion transmembrane transport    The directed movement of hydrogen ion (proton) across a membrane.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

Chain C   (PNTB_RHORU | P0C188)
molecular function
    GO:0008750    NAD(P)+ transhydrogenase (AB-specific) activity    Catalysis of the reaction: NADPH + H+ + NAD+ = NADP+ + NADH + H+. The reaction is A-specific (i.e. the pro-R hydrogen is transferred from the 4-position of reduced nicotinamide cofactor) with respect to NAD+ and B-specific (i.e. the pro-S hydrogen is transferred) with respect to NADP+.
    GO:0050661    NADP binding    Interacting selectively and non-covalently with nicotinamide-adenine dinucleotide phosphate, a coenzyme involved in many redox and biosynthetic reactions; binding may be to either the oxidized form, NADP+, or the reduced form, NADPH.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    TXP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Asn C:45 - Ala C:46   [ RasMol ]  
    Met B:1 - Lys B:2   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2oor
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PNTAA_RHORT | Q2RSB2
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PNTAA_RHORU | P0C186
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PNTB_RHORU | P0C188
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.6.1.2
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  PNTAA_RHORT | Q2RSB2
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PNTAA_RHORU | P0C186
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PNTB_RHORU | P0C188
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PNTAA_RHORT | Q2RSB2: 1f8g 1hzz 1l7d 1l7e 1nm5 1ptj 1u28 1u2d 1u2g 1xlt 2fr8 2frd 2fsv 2oo5
        PNTAA_RHORU | P0C186: 1f8g 1hzz 1l7d 1l7e 1nm5 1ptj 1u28 1u2d 1u2g 1xlt 2fr8 2frd 2fsv 2oo5
        PNTB_RHORU | P0C188: 1e3t 1hzz 1nm5 1pno 1pnq 1ptj 1u28 1u2d 1u2g 1xlt 2fr8 2frd 2fsv 2oo5

(-) Related Entries Specified in the PDB File

1hzz 1u2d 2oo5