Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Biol.Unit 1 - manually
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Biol.Unit 1 - manually
Biol.Unit 1 - manually  (Jmol Viewer)
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PUTATIVE REGULATORY PROTEIN SCO4313
 
Authors :  C. Chang, X. Xu, H. Zheng, A. Savchenko, A. M. Edwards, A. Joachimiak, Mi Center For Structural Genomics (Mcsg)
Date :  10 Jan 07  (Deposition) - 13 Feb 07  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.50
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Keywords :  Tetr, Streptomyces Coelicolor, Structural Genomics, Psi-2, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg, Transcription (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  C. Chang, X. Xu, H. Zheng, A. Savchenko, A. M. Edwards, A. Joachimiak
Crystal Structure Of Tetr Family Protein Sco4313
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PUTATIVE REGULATORY PROTEIN SCO4313
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET DERIVATIVE
    Expression System Strain: BL21(DE3) DERIVATIVE
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: SCO4313
    Organism Scientific: STREPTOMYCES COELICOLOR
    Organism Taxid: 1902

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : A
Biological Unit 1 (2x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

Asymmetric Unit (1, 4)
No.NameCountTypeFull Name
1MSE4Mod. Amino AcidSELENOMETHIONINE
Biological Unit 1 (1, 8)
No.NameCountTypeFull Name
1MSE8Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 2OI8)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2OI8)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2OI8)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2OI8)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2OI8)

(-) Exons   (0, 0)

(no "Exon" information available for 2OI8)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:203
 aligned with Q9KXS8_STRCO | Q9KXS8 from UniProtKB/TrEMBL  Length:216

    Alignment length:209
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207         
         Q9KXS8_STRCO     8 TPRERYRTQVRAEIKDHAWEQIATAGASALSLNAIAKRMGMSGPALYRYFDGRDELITELIRDAYRSQADSLRAAAASGADLAGLAHALRAWALDDPQRYFLIFGTPVPGYRAPDDITEIAAETMAVIVDACAALPPSDGTDGAFDAHLDTHRQWAGDRPAPSSALHRALSFWSRLHGVLSLELAGQFTGMGFDSALLFEAELKDLLGP 216
               SCOP domains d2oi8a1 A:8-86 Putative regulatory protein Sco4313                             d2oi8a2 A:87-216 Putative regulatory protein Sco4313                                                                               SCOP domains
               CATH domains 2oi8A00 A:8-216 Tetracycline Repressor, domain 2                                                                                                                                                                  CATH domains
               Pfam domains -------------TetR_N-2oi8A01 A:21-67                         ----------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhhhhhh....hhhhhhhhh..hhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh........hhhhh..hhhhhhhhhhhhh.-----...hhhhhhhhhh....-....hhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2oi8 A   8 TPRERYRTQVRAEIKDHAWEQIATAGASALSLNAIAKRmGmSGPALYRYFDGRDELITELIRDAYRSQADSLRAAAASGADLAGLAHALRAWALDDPQRYFLIFGTPVPGYRAPDDITEIAAETmAVIVDACAA-----GTDGAFDAHLDTHRQWA-DRPAPSSALHRALSFWSRLHGVLSLELAGQFTGmGFDSALLFEAELKDLLGP 216
                                    17        27        37        47|       57        67        77        87        97       107       117       127    |  137   |   147       157     | 167       177       187       197|      207         
                                                                 46-MSE                                                                               132-MSE  141   147             163 |                              198-MSE              
                                                                   48-MSE                                                                                                              165
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

Asymmetric Unit
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (1, 1)

Asymmetric Unit
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (1, 1)

Asymmetric Unit
(-)
Clan: HTH (544)

(-) Gene Ontology  (3, 3)

Asymmetric Unit(hide GO term definitions)
Chain A   (Q9KXS8_STRCO | Q9KXS8)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
biological process
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 2oi8)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2oi8)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2oi8
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9KXS8_STRCO | Q9KXS8
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q9KXS8_STRCO | Q9KXS8
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2OI8)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2OI8)