Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CENTRIN-XPC PEPTIDE
 
Authors :  J. B. Charbonnier
Date :  19 Dec 06  (Deposition) - 09 Oct 07  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Dna Repair Complex Ef Hand Superfamily Protein-Peptide Complex, Cell Cycle (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. B. Charbonnier, E. Renaud, S. Miron, M. H. Le Du, Y. Blouquit, P. Duchambon, P. Christova, A. Shosheva, T. Rose, J. F. Angulo, C. T. Craescu
Structural, Thermodynamic, And Cellular Characterization Of Human Centrin 2 Interaction With Xeroderma Pigmentosum Grou C Protein.
J. Mol. Biol. V. 373 1032 2007
PubMed-ID: 17897675  |  Reference-DOI: 10.1016/J.JMB.2007.08.046
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CENTRIN-2
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PET24A(+)
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: CETN2, CALT, CEN2
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: CALTRACTIN ISOFORM 1
 
Molecule 2 - DNA-REPAIR PROTEIN COMPLEMENTING XP-C CELLS
    Chains: C, D
    Engineered: YES
    Other Details: THIS SEQUENCE OCCURS IN HOMO SAPIENS
    Synonym: XERODERMA PIGMENTOSUM GROUP C-COMPLEMENTING PROTEIN, P125
    Synthetic: YES

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit : ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 6)

Asymmetric/Biological Unit (2, 6)
No.NameCountTypeFull Name
1ACE2Mod. Amino AcidACETYL GROUP
2CA4Ligand/IonCALCIUM ION

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASP A:150 , ASP A:152 , ASP A:154 , GLU A:156 , GLU A:161 , HOH A:1003BINDING SITE FOR RESIDUE CA A 1001
2AC2SOFTWAREASP A:114 , ASP A:116 , THR A:118 , LYS A:120 , ASN A:125 , HOH A:1004BINDING SITE FOR RESIDUE CA A 1002
3AC3SOFTWAREASP B:150 , ASP B:152 , ASP B:154 , GLU B:156 , GLU B:161 , HOH B:1003BINDING SITE FOR RESIDUE CA B 1001
4AC4SOFTWAREASP B:114 , ASP B:116 , THR B:118 , LYS B:120 , ASN B:125 , HOH B:1004BINDING SITE FOR RESIDUE CA B 1002

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2OBH)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2OBH)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2OBH)

(-) PROSITE Motifs  (2, 12)

Asymmetric/Biological Unit (2, 12)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1EF_HAND_2PS50222 EF-hand calcium-binding domain profile.CETN2_HUMAN28-63
 
64-99
 
101-136
 
137-172
 		  8A:28-63
B:28-63
A:64-99
B:64-99
A:101-136
B:101-136
A:137-168
B:137-168
2EF_HAND_1PS00018 EF-hand calcium-binding domain.CETN2_HUMAN41-53
 
150-162
 		  4A:41-53
B:41-53
A:150-162
B:150-162

(-) Exons   (5, 10)

Asymmetric/Biological Unit (5, 10)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000002850211aENSE00002078782chr3:14220283-14219966318XPC_HUMAN1-35350--
1.2ENST000002850212ENSE00001160413chr3:14214562-14214367196XPC_HUMAN35-100660--
1.3cENST000002850213cENSE00001160407chr3:14212050-14211938113XPC_HUMAN100-138390--
1.4bENST000002850214bENSE00001711961chr3:14209880-14209757124XPC_HUMAN138-179420--
1.5bENST000002850215bENSE00001790537chr3:14208753-1420866985XPC_HUMAN179-207290--
1.6ENST000002850216ENSE00001693781chr3:14207085-14206928158XPC_HUMAN208-260530--
1.7bENST000002850217bENSE00001160376chr3:14206433-14206313121XPC_HUMAN260-300410--
1.8ENST000002850218ENSE00001160371chr3:14201330-1420124190XPC_HUMAN301-330300--
1.9bENST000002850219bENSE00001017578chr3:14200392-14199511882XPC_HUMAN331-6242940--
1.10ENST0000028502110ENSE00001289098chr3:14197995-14197835161XPC_HUMAN625-678540--
1.11ENST0000028502111ENSE00001160334chr3:14193916-1419383582XPC_HUMAN678-705280--
1.12aENST0000028502112aENSE00001160328chr3:14190448-14190314135XPC_HUMAN706-750450--
1.13ENST0000028502113ENSE00001160320chr3:14190231-14190062170XPC_HUMAN751-807570--
1.14aENST0000028502114aENSE00001160311chr3:14189501-1418940894XPC_HUMAN807-838320--
1.15ENST0000028502115ENSE00001160303chr3:14188879-1418879090XPC_HUMAN839-868302C:846-862
D:846-863		17
18
1.16cENST0000028502116cENSE00001914924chr3:14187659-141866471013XPC_HUMAN869-940720--
2.1ENST000003702771ENSE00001452251X:151999321-15199925270CETN2_HUMAN1-110--
2.2aENST000003702772aENSE00001302515X:151998304-151998146159CETN2_HUMAN2-54532A:26-54
B:26-54		29
29
2.3aENST000003702773aENSE00000979874X:151997821-151997693129CETN2_HUMAN55-97432A:55-97
B:55-97		43
43
2.3cENST000003702773cENSE00000979875X:151997218-151997081138CETN2_HUMAN98-143462A:98-143
B:98-143		46
46
2.4bENST000003702774bENSE00001452248X:151996474-151995517958CETN2_HUMAN144-172292A:144-168
B:144-168		25
25

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:143
 aligned with CETN2_HUMAN | P41208 from UniProtKB/Swiss-Prot  Length:172

    Alignment length:143
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165   
          CETN2_HUMAN    26 TEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKK 168
               SCOP domains d2obha_ A: Calmodulin                                                                                                                           SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhh.......eee..hhhhhhhhh....hhhhhhhhhhhhh.....eeehhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh....hhhhhhhhhhhhh.......hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --EF_HAND_2  PDB: A:28-63             EF_HAND_2  PDB: A:64-99             -EF_HAND_2  PDB: A:101-136           EF_HAND_2  PDB: A:137-168        PROSITE (1)
                PROSITE (2) ---------------EF_HAND_1    ------------------------------------------------------------------------------------------------EF_HAND_1    ------ PROSITE (2)
               Transcript 2 Exon 2.2a  PDB: A:26-54      Exon 2.3a  PDB: A:55-97 UniProt: 55-97     Exon 2.3c  PDB: A:98-143 UniProt: 98-143      Exon 2.4b  PDB: A:144-168 Transcript 2
                 2obh A  26 TEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKK 168
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165   


Chain B from PDB  Type:PROTEIN  Length:143
 aligned with CETN2_HUMAN | P41208 from UniProtKB/Swiss-Prot  Length:172

    Alignment length:143
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165   
          CETN2_HUMAN    26 TEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKK 168
               SCOP domains d2obhb_ B: Calmodulin                                                                                                                           SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ------EF_hand_5-2obhB01 B:32-93                                     -----------------------EF_hand_6-2obhB03 B:117-168                          Pfam domains (1)
           Pfam domains (2) ------EF_hand_5-2obhB02 B:32-93                                     -----------------------EF_hand_6-2obhB04 B:117-168                          Pfam domains (2)
           Pfam domains (3) -------------------------------------------------------------------------------------------------------------------efhand-2obhB05 B:141-168     Pfam domains (3)
           Pfam domains (4) -------------------------------------------------------------------------------------------------------------------efhand-2obhB06 B:141-168     Pfam domains (4)
         Sec.struct. author hhhhhhhhhhhhhhh......eee..hhhhhhhhh....hhhhhhhhhhhhh.....eeehhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh....hhhhhhhhhhhhh.......hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --EF_HAND_2  PDB: B:28-63             EF_HAND_2  PDB: B:64-99             -EF_HAND_2  PDB: B:101-136           EF_HAND_2  PDB: B:137-168        PROSITE (1)
                PROSITE (2) ---------------EF_HAND_1    ------------------------------------------------------------------------------------------------EF_HAND_1    ------ PROSITE (2)
               Transcript 2 Exon 2.2a  PDB: B:26-54      Exon 2.3a  PDB: B:55-97 UniProt: 55-97     Exon 2.3c  PDB: B:98-143 UniProt: 98-143      Exon 2.4b  PDB: B:144-168 Transcript 2
                 2obh B  26 TEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKK 168
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165   


Chain C from PDB  Type:PROTEIN  Length:17
 aligned with XPC_HUMAN | Q01831 from UniProtKB/Swiss-Prot  Length:940

    Alignment length:17
                                   855       
            XPC_HUMAN   846 GNWKLLAKGLLIRERLK 862
               SCOP domains ----------------- SCOP domains
               CATH domains ----------------- CATH domains
               Pfam domains ----------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------- SAPs(SNPs)
                    PROSITE ----------------- PROSITE
               Transcript 1 Exon 1.15         Transcript 1
                 2obh C 846 xNWKLLAKGLLIRERLK 862
                            |      855       
                          846-ACE            


Chain D from PDB  Type:PROTEIN  Length:18
 aligned with XPC_HUMAN | Q01831 from UniProtKB/Swiss-Prot  Length:940

    Alignment length:18
                                   855        
            XPC_HUMAN   846 GNWKLLAKGLLIRERLKR 863
               SCOP domains ------------------ SCOP domains
               CATH domains ------------------ CATH domains
               Pfam domains ------------------ Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------ SAPs(SNPs)
                    PROSITE ------------------ PROSITE
               Transcript 1 Exon 1.15          Transcript 1
                 2obh D 846 xNWKLLAKGLLIRERLKR 863
                            |      855        
                          846-ACE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2OBH)

(-) Pfam Domains  (3, 6)

Asymmetric/Biological Unit
(-)
Clan: EF_hand (270)

(-) Gene Ontology  (48, 61)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (CETN2_HUMAN | P41208)
molecular function
    GO:0031683    G-protein beta/gamma-subunit complex binding    Interacting selectively and non-covalently with a complex of G-protein beta/gamma subunits.
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0032795    heterotrimeric G-protein binding    Interacting selectively and non-covalently with a heterotrimeric G-protein.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0008017    microtubule binding    Interacting selectively and non-covalently with microtubules, filaments composed of tubulin monomers.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0006281    DNA repair    The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
    GO:0000086    G2/M transition of mitotic cell cycle    The mitotic cell cycle transition by which a cell in G2 commits to M phase. The process begins when the kinase activity of M cyclin/CDK complex reaches a threshold high enough for the cell cycle to proceed. This is accomplished by activating a positive feedback loop that results in the accumulation of unphosphorylated and active M cyclin/CDK complex.
    GO:0007049    cell cycle    The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
    GO:0051301    cell division    The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.
    GO:0006974    cellular response to DNA damage stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
    GO:0007099    centriole replication    The cell cycle process in which a daughter centriole is formed perpendicular to an existing centriole. An immature centriole contains a ninefold radially symmetric array of single microtubules; mature centrioles consist of a radial array of nine microtubule triplets, doublets, or singlets depending upon the species and cell type. Duplicated centrioles also become the ciliary basal body in cells that form cilia during G0.
    GO:0070911    global genome nucleotide-excision repair    The nucleotide-excision repair process in which DNA lesions are removed from nontranscribed strands and from transcriptionally silent regions over the entire genome.
    GO:0006289    nucleotide-excision repair    A DNA repair process in which a small region of the strand surrounding the damage is removed from the DNA helix as an oligonucleotide. The small gap left in the DNA helix is filled in by the sequential action of DNA polymerase and DNA ligase. Nucleotide excision repair recognizes a wide range of substrates, including damage caused by UV irradiation (pyrimidine dimers and 6-4 photoproducts) and chemicals (intrastrand cross-links and bulky adducts).
    GO:0000715    nucleotide-excision repair, DNA damage recognition    The identification of lesions in DNA, such as pyrimidine-dimers, intrastrand cross-links, and bulky adducts. The wide range of substrate specificity suggests the repair complex recognizes distortions in the DNA helix.
    GO:0000717    nucleotide-excision repair, DNA duplex unwinding    The unwinding, or local denaturation, of the DNA duplex to create a bubble around the site of the DNA damage.
    GO:0006294    nucleotide-excision repair, preincision complex assembly    The aggregation, arrangement and bonding together of proteins on DNA to form the multiprotein complex involved in damage recognition, DNA helix unwinding, and endonucleolytic cleavage at the site of DNA damage. This assembly occurs before the phosphodiester backbone of the damaged strand is cleaved 3' and 5' of the site of DNA damage.
    GO:0016925    protein sumoylation    The process in which a SUMO protein (small ubiquitin-related modifier) is conjugated to a target protein via an isopeptide bond between the carboxyl terminus of SUMO with an epsilon-amino group of a lysine residue of the target protein.
    GO:0032465    regulation of cytokinesis    Any process that modulates the frequency, rate or extent of the division of the cytoplasm of a cell and its separation into two daughter cells.
    GO:0007283    spermatogenesis    The process of formation of spermatozoa, including spermatocytogenesis and spermiogenesis.
cellular component
    GO:0071942    XPC complex    A nucleotide-excision repair complex that is involved in damage sensing during global genome nucleotide excision repair (GG-NER). It is part of the pre-incision (or initial recognition) complex bound to sites of DNA damage. In human, it is composed of XPC, RAD23B and CETN2.
    GO:0005814    centriole    A cellular organelle, found close to the nucleus in many eukaryotic cells, consisting of a small cylinder with microtubular walls, 300-500 nm long and 150-250 nm in diameter. It contains nine short, parallel, peripheral microtubular fibrils, each fibril consisting of one complete microtubule fused to two incomplete microtubules. Cells usually have two centrioles, lying at right angles to each other. At division, each pair of centrioles generates another pair and the twin pairs form the pole of the mitotic spindle.
    GO:0005813    centrosome    A structure comprised of a core structure (in most organisms, a pair of centrioles) and peripheral material from which a microtubule-based structure, such as a spindle apparatus, is organized. Centrosomes occur close to the nucleus during interphase in many eukaryotic cells, though in animal cells it changes continually during the cell-division cycle.
    GO:0036064    ciliary basal body    A membrane-tethered, short cylindrical array of microtubules and associated proteins found at the base of a eukaryotic cilium (also called flagellum) that is similar in structure to a centriole and derives from it. The cilium basal body is the site of assembly and remodelling of the cilium and serves as a nucleation site for axoneme growth. As well as anchoring the cilium, it is thought to provide a selective gateway regulating the entry of ciliary proteins and vesicles by intraflagellar transport.
    GO:0005929    cilium    A specialized eukaryotic organelle that consists of a filiform extrusion of the cell surface and of some cytoplasmic parts. Each cilium is largely bounded by an extrusion of the cytoplasmic (plasma) membrane, and contains a regular longitudinal array of microtubules, anchored to a basal body.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005856    cytoskeleton    Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0032391    photoreceptor connecting cilium    The portion of the photoreceptor cell cilium linking the photoreceptor inner and outer segments. It's considered to be equivalent to the ciliary transition zone.

Chain C,D   (XPC_HUMAN | Q01831)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0000405    bubble DNA binding    Interacting selectively and non-covalently with DNA that contains a bubble. A bubble occurs when DNA contains a region of unpaired, single-stranded DNA flanked on both sides by regions of paired, double-stranded DNA.
    GO:0003684    damaged DNA binding    Interacting selectively and non-covalently with damaged DNA.
    GO:0000404    heteroduplex DNA loop binding    Interacting selectively and non-covalently with DNA containing a loop. A loop occurs when DNA contains a large insertion or deletion that causes a region of unpaired single-stranded DNA to loop out, while the rest of the DNA is in a paired double-stranded configuration.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0003697    single-stranded DNA binding    Interacting selectively and non-covalently with single-stranded DNA.
biological process
    GO:0006281    DNA repair    The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
    GO:0070914    UV-damage excision repair    A DNA repair process that is initiated by an endonuclease that introduces a single-strand incision immediately 5' of a UV-induced damage site. UV-damage excision repair acts on both cyclobutane pyrimidine dimers (CPDs) and pyrimidine-pyrimidone 6-4 photoproducts (6-4PPs).
    GO:0006974    cellular response to DNA damage stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
    GO:0070911    global genome nucleotide-excision repair    The nucleotide-excision repair process in which DNA lesions are removed from nontranscribed strands and from transcriptionally silent regions over the entire genome.
    GO:0031573    intra-S DNA damage checkpoint    A mitotic cell cycle checkpoint that slows DNA synthesis in response to DNA damage by the prevention of new origin firing and the stabilization of slow replication fork progression.
    GO:0006298    mismatch repair    A system for the correction of errors in which an incorrect base, which cannot form hydrogen bonds with the corresponding base in the parent strand, is incorporated into the daughter strand. The mismatch repair system promotes genomic fidelity by repairing base-base mismatches, insertion-deletion loops and heterologies generated during DNA replication and recombination.
    GO:0006289    nucleotide-excision repair    A DNA repair process in which a small region of the strand surrounding the damage is removed from the DNA helix as an oligonucleotide. The small gap left in the DNA helix is filled in by the sequential action of DNA polymerase and DNA ligase. Nucleotide excision repair recognizes a wide range of substrates, including damage caused by UV irradiation (pyrimidine dimers and 6-4 photoproducts) and chemicals (intrastrand cross-links and bulky adducts).
    GO:0000715    nucleotide-excision repair, DNA damage recognition    The identification of lesions in DNA, such as pyrimidine-dimers, intrastrand cross-links, and bulky adducts. The wide range of substrate specificity suggests the repair complex recognizes distortions in the DNA helix.
    GO:0000717    nucleotide-excision repair, DNA duplex unwinding    The unwinding, or local denaturation, of the DNA duplex to create a bubble around the site of the DNA damage.
    GO:0006294    nucleotide-excision repair, preincision complex assembly    The aggregation, arrangement and bonding together of proteins on DNA to form the multiprotein complex involved in damage recognition, DNA helix unwinding, and endonucleolytic cleavage at the site of DNA damage. This assembly occurs before the phosphodiester backbone of the damaged strand is cleaved 3' and 5' of the site of DNA damage.
    GO:0016925    protein sumoylation    The process in which a SUMO protein (small ubiquitin-related modifier) is conjugated to a target protein via an isopeptide bond between the carboxyl terminus of SUMO with an epsilon-amino group of a lysine residue of the target protein.
    GO:1901990    regulation of mitotic cell cycle phase transition    Any process that modulates the frequency, rate or extent of mitotic cell cycle phase transition.
    GO:0010224    response to UV-B    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a UV-B radiation stimulus. UV-B radiation (UV-B light) spans the wavelengths 280 to 315 nm.
    GO:0010996    response to auditory stimulus    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an auditory stimulus.
    GO:0042493    response to drug    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
cellular component
    GO:0071942    XPC complex    A nucleotide-excision repair complex that is involved in damage sensing during global genome nucleotide excision repair (GG-NER). It is part of the pre-incision (or initial recognition) complex bound to sites of DNA damage. In human, it is composed of XPC, RAD23B and CETN2.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005730    nucleolus    A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0000111    nucleotide-excision repair factor 2 complex    One of several protein complexes involved in nucleotide-excision repair; possesses damaged DNA binding activity. In S. cerevisiae, it is composed of Rad4p and Rad23p.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ACE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2obh)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2obh
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CETN2_HUMAN | P41208
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  XPC_HUMAN | Q01831
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CETN2_HUMAN | P41208
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  XPC_HUMAN | Q01831
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CETN2_HUMAN | P41208: 1m39 1zmz 2a4j 2ggm 2k2i
        XPC_HUMAN | Q01831: 2a4j 2ggm 2rvb

(-) Related Entries Specified in the PDB File

2a4j SAME COMPLEXE WITH CTER (T94-Y172) OF CENTRIN AND BY NMR
2ggm SAME COMPLEX WITH FULL LENGTH CENTRIN BY XRAY AT 2.3A