2O6G - JenaLib

Asym./Biol. Unit - manually (Jmol Viewer)

Asym./Biol. Unit (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF IRF-3 BOUND TO THE INTERFERON-B ENHANCER

Authors :   D. Panne

Date :   07 Dec 06 (Deposition) - 24 Jul 07 (Release) - 17 Nov 10 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   3.10

Chains :   Asym./Biol. Unit : C,D,E,F,G,H

Keywords :   Protein-Dna Complex, Transcription-Dna Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   D. Panne, T. Maniatis, S. C. Harrison
An Atomic Model Of The Interferon-Beta Enhanceosome.
Cell(Cambridge, Mass. ) V. 129 1111 2007
PubMed-ID: 17574024 | Reference-DOI: 10.1016/J.CELL.2007.05.019

Molecule 1 - INTERFERON-B ENHANCER
	Chains	:	D
	Engineered	:	YES
	Synthetic	:	YES

Molecule 2 - INTERFERON-B ENHANCER
	Chains	:	C
	Engineered	:	YES
	Synthetic	:	YES

Molecule 3 - INTERFERON REGULATORY FACTOR 3
	Chains	:	E, F, G, H
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Fragment	:	DNA BINDING DOMAIN, RESIDUES 3-112
	Gene	:	IRF3
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	IRF-3

		1	2	3	4	5	6
Asymmetric/Biological Unit	:	C	D	E	F	G	H

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2O6G)

(no "Site" information available for 2O6G)

(no "SS Bond" information available for 2O6G)

(no "Cis Peptide Bond" information available for 2O6G)

Asymmetric/Biological Unit (2, 8)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_011901	R	96	Q	IRF3_HUMAN	Polymorphism	968457	E/F/G/H	R	96	Q
2	UniProt	VAR_049643	Y	107	F	IRF3_HUMAN	Polymorphism	34745118	E/F/G/H	Y	107	F

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric/Biological Unit (2, 8)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	IRF_2	PS51507	IRF tryptophan pentad repeat DNA-binding domain profile.	IRF3_HUMAN	5-111	4	E:5-111 F:5-111 G:5-111 H:5-111
2	IRF_1	PS00601	IRF tryptophan pentad repeat DNA-binding domain signature.	IRF3_HUMAN	26-58	4	E:26-58 F:26-58 G:26-58 H:26-58

Asymmetric/Biological Unit (2, 8)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000377139	1a	ENSE00001741588	chr19:50169132-50168888	245	IRF3_HUMAN	-	0	0	-	-
1.2	ENST00000377139	2	ENSE00001192374	chr19:50168103-50167931	173	IRF3_HUMAN	1-55	55	4	E:3-55 F:4-55 G:3-55 H:4-55	53 52 53 52
1.3	ENST00000377139	3	ENSE00000720991	chr19:50166771-50166600	172	IRF3_HUMAN	56-113	58	4	E:56-112 F:56-111 G:56-112 H:56-111	57 56 57 56
1.4	ENST00000377139	4	ENSE00001762773	chr19:50166515-50166445	71	IRF3_HUMAN	113-136	24	0	-	-
1.5	ENST00000377139	5	ENSE00001662781	chr19:50165874-50165682	193	IRF3_HUMAN	137-201	65	0	-	-
1.6	ENST00000377139	6	ENSE00001759095	chr19:50165585-50165205	381	IRF3_HUMAN	201-328	128	0	-	-
1.7b	ENST00000377139	7b	ENSE00001699705	chr19:50164085-50163970	116	IRF3_HUMAN	328-366	39	0	-	-
1.8b	ENST00000377139	8b	ENSE00001707173	chr19:50163090-50162829	262	IRF3_HUMAN	367-427	61	0	-	-

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain C from PDB  Type:DNA  Length:57
                                                                                         
                 2o6g C   1 ATCTATTCAGAGGAATTTCCCACTTTCACTTTCCCTTTCAGTTTCCCTATGTCATTT  57
                                    10        20        30        40        50

Chain D from PDB  Type:DNA  Length:57
                                                                                         
                 2o6g D   1 TAAATGACATAGGGAAACTGAAAGGGAAAGTGAAAGTGGGAAATTCCTCTGAATAGA  57
                                    10        20        30        40        50

Chain E from PDB  Type:PROTEIN  Length:110
 aligned with IRF3_HUMAN | Q14653 from UniProtKB/Swiss-Prot  Length:427

    Alignment length:110
                                    12        22        32        42        52        62        72        82        92       102       112
           IRF3_HUMAN     3 TPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNS 112
               SCOP domains d2o6ge_ E: Interferon regulatory factor 3, IRF-3                                                               SCOP domains
               CATH domains ----2o6gE01 E:7-110 'winged helix' repressor DNA binding domain                                             -- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhh.............eee...............hhhhhhhhhhh..........hhhhhhhhhhhhhhhh...eeee...........eee.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------Q----------F----- SAPs(SNPs)
                PROSITE (1) --IRF_2  PDB: E:5-111 UniProt: 5-111                                                                         - PROSITE (1)
                PROSITE (2) -----------------------IRF_1  PDB: E:26-58              ------------------------------------------------------ PROSITE (2)
               Transcript 1 Exon 1.2  PDB: E:3-55 UniProt: 1-55 [INCOMPLETE]     Exon 1.3  PDB: E:56-112 UniProt: 56-113 [INCOMPLETE]      Transcript 1
                 2o6g E   3 TPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNS 112
                                    12        22        32        42        52        62        72        82        92       102       112

Chain F from PDB  Type:PROTEIN  Length:108
 aligned with IRF3_HUMAN | Q14653 from UniProtKB/Swiss-Prot  Length:427

    Alignment length:108
                                    13        23        33        43        53        63        73        83        93       103        
           IRF3_HUMAN     4 PKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVN 111
               SCOP domains d2o6gf_ F: Interferon regulatory factor 3, IRF-3                                                             SCOP domains
               CATH domains ---2o6gF01 F:7-110 'winged helix' repressor DNA binding domain                                             - CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhh.....ee......eeeee.........hhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhh...eeeeee.......eeeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------Q----------F---- SAPs(SNPs)
                PROSITE (1) -IRF_2  PDB: F:5-111 UniProt: 5-111                                                                          PROSITE (1)
                PROSITE (2) ----------------------IRF_1  PDB: F:26-58              ----------------------------------------------------- PROSITE (2)
               Transcript 1 Exon 1.2  PDB: F:4-55 UniProt: 1-55 [INCOMPLETE]    Exon 1.3  PDB: F:56-111 UniProt: 56-113 [INCOMPLETE]     Transcript 1
                 2o6g F   4 PKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVN 111
                                    13        23        33        43        53        63        73        83        93       103

Chain G from PDB  Type:PROTEIN  Length:110
 aligned with IRF3_HUMAN | Q14653 from UniProtKB/Swiss-Prot  Length:427

    Alignment length:110
                                    12        22        32        42        52        62        72        82        92       102       112
           IRF3_HUMAN     3 TPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNS 112
               SCOP domains d2o6gg_ G: Interferon regulatory factor 3, IRF-3                                                               SCOP domains
               CATH domains ----2o6gG01 G:7-110 'winged helix' repressor DNA binding domain                                             -- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhh.....ee......eeeee.........hhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhh..eeeeeee.......eeeeee... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------Q----------F----- SAPs(SNPs)
                PROSITE (1) --IRF_2  PDB: G:5-111 UniProt: 5-111                                                                         - PROSITE (1)
                PROSITE (2) -----------------------IRF_1  PDB: G:26-58              ------------------------------------------------------ PROSITE (2)
               Transcript 1 Exon 1.2  PDB: G:3-55 UniProt: 1-55 [INCOMPLETE]     Exon 1.3  PDB: G:56-112 UniProt: 56-113 [INCOMPLETE]      Transcript 1
                 2o6g G   3 TPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNS 112
                                    12        22        32        42        52        62        72        82        92       102       112

Chain H from PDB  Type:PROTEIN  Length:108
 aligned with IRF3_HUMAN | Q14653 from UniProtKB/Swiss-Prot  Length:427

    Alignment length:108
                                    13        23        33        43        53        63        73        83        93       103        
           IRF3_HUMAN     4 PKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVN 111
               SCOP domains d2o6gh_ H: Interferon regulatory factor 3, IRF-3                                                             SCOP domains
               CATH domains ---2o6gH01 H:7-110 'winged helix' repressor DNA binding domain                                             - CATH domains
           Pfam domains (1) -IRF-2o6gH01 H:5-111                                                                                         Pfam domains (1)
           Pfam domains (2) -IRF-2o6gH02 H:5-111                                                                                         Pfam domains (2)
           Pfam domains (3) -IRF-2o6gH03 H:5-111                                                                                         Pfam domains (3)
           Pfam domains (4) -IRF-2o6gH04 H:5-111                                                                                         Pfam domains (4)
         Sec.struct. author ...hhhhhhhhhhhhh.....ee......eeeee.........hhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhh..eeeeeee.......eeeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------Q----------F---- SAPs(SNPs)
                PROSITE (1) -IRF_2  PDB: H:5-111 UniProt: 5-111                                                                          PROSITE (1)
                PROSITE (2) ----------------------IRF_1  PDB: H:26-58              ----------------------------------------------------- PROSITE (2)
               Transcript 1 Exon 1.2  PDB: H:4-55 UniProt: 1-55 [INCOMPLETE]    Exon 1.3  PDB: H:56-111 UniProt: 56-113 [INCOMPLETE]     Transcript 1
                 2o6g H   4 PKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVN 111
                                    13        23        33        43        53        63        73        83        93       103

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: DNA/RNA-binding 3-helical bundle (1299)

Superfamily: Winged helix DNA-binding domain (576)

Family: Interferon regulatory factor (8)

Protein domain: Interferon regulatory factor 3, IRF-3 (3)

Human (Homo sapiens) [TaxId: 9606] (3)

1a	d2o6ge_	E:
1b	d2o6gf_	F:
1c	d2o6gg_	G:
1d	d2o6gh_	H:

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Orthogonal Bundle (10391)

Topology: Arc Repressor Mutant, subunit A (1030)

Homologous Superfamily: 'winged helix' repressor DNA binding domain (507)

[unclassified] (77)

1a	2o6gE01	E:7-110
1b	2o6gF01	F:7-110
1c	2o6gG01	G:7-110
1d	2o6gH01	H:7-110

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: no clan defined [family: IRF] (4)

Family: IRF (4)

Homo sapiens (Human) (3)

1a	IRF-2o6gH01	H:5-111
1b	IRF-2o6gH02	H:5-111
1c	IRF-2o6gH03	H:5-111
1d	IRF-2o6gH04	H:5-111

Asymmetric/Biological Unit(hide GO term definitions)

Chain E,F,G,H (IRF3_HUMAN | Q14653)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0000978	RNA polymerase II core promoter proximal region sequence-specific DNA binding	Interacting selectively and non-covalently with a sequence of DNA that is in cis with and relatively close to a core promoter for RNA polymerase II.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0000975	regulatory region DNA binding	Interacting selectively and non-covalently with a DNA region that regulates a DNA-based process. Such processes include transcription, DNA replication, and DNA repair.
	GO:0003712	transcription cofactor activity	Interacting selectively and non-covalently with a regulatory transcription factor and also with the basal transcription machinery in order to modulate transcription. Cofactors generally do not bind the template nucleic acid, but rather mediate protein-protein interactions between regulatory transcription factors and the basal transcription machinery.
	GO:0003700	transcription factor activity, sequence-specific DNA binding	Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
	GO:0001078	transcriptional repressor activity, RNA polymerase II core promoter proximal region sequence-specific binding	Interacting selectively and non-covalently with a sequence of DNA that is in cis with and relatively close to a core promoter for RNA polymerase II (RNAP II) in order to stop, prevent, or reduce the frequency, rate or extent of transcription from an RNA polymerase II promoter.
biological process
	GO:0039530	MDA-5 signaling pathway	Any series of molecular signals generated as a consequence of the cytoplasmic pattern recognition receptor (PRR) MDA-5 (also known as IFIH1) binding to viral RNA. MDA-5 detects RNA synthesized during active viral replication and triggers a signaling pathway to protect the host against viral infection, for example by inducing the expression of antiviral cytokines.
	GO:0035666	TRIF-dependent toll-like receptor signaling pathway	Any series of molecular signals generated as a consequence of binding to a toll-like receptor where the TRIF adaptor mediates transduction of the signal. Toll-like receptors directly bind pattern motifs from a variety of microbial sources to initiate innate immune response.
	GO:0006915	apoptotic process	A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
	GO:0006974	cellular response to DNA damage stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
	GO:0071359	cellular response to dsRNA	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a double-stranded RNA stimulus.
	GO:0071222	cellular response to lipopolysaccharide	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipopolysaccharide stimulus; lipopolysaccharide is a major component of the cell wall of gram-negative bacteria.
	GO:0051607	defense response to virus	Reactions triggered in response to the presence of a virus that act to protect the cell or organism.
	GO:0002376	immune system process	Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
	GO:0045087	innate immune response	Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
	GO:0060333	interferon-gamma-mediated signaling pathway	A series of molecular signals initiated by the binding of interferon-gamma to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription. Interferon gamma is the only member of the type II interferon found so far.
	GO:0031663	lipopolysaccharide-mediated signaling pathway	A series of molecular signals initiated by the binding of a lipopolysaccharide (LPS) to a receptor on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription. Lipopolysaccharides are major components of the outer membrane of Gram-negative bacteria, making them prime targets for recognition by the immune system.
	GO:0071888	macrophage apoptotic process	Any apoptotic process in a macrophage, a mononuclear phagocyte present in a variety of tissues.
	GO:0000122	negative regulation of transcription from RNA polymerase II promoter	Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0032480	negative regulation of type I interferon production	Any process that stops, prevents, or reduces the frequency, rate, or extent of type I interferon production. Type I interferons include the interferon-alpha, beta, delta, episilon, zeta, kappa, tau, and omega gene families.
	GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	Any process that activates or increases the frequency, rate or extent of I-kappaB kinase/NF-kappaB signaling.
	GO:0050715	positive regulation of cytokine secretion	Any process that activates or increases the frequency, rate or extent of the regulated release of cytokines from a cell.
	GO:0032727	positive regulation of interferon-alpha production	Any process that activates or increases the frequency, rate, or extent of interferon-alpha production.
	GO:0032728	positive regulation of interferon-beta production	Any process that activates or increases the frequency, rate, or extent of interferon-beta production.
	GO:0032481	positive regulation of type I interferon production	Any process that activates or increases the frequency, rate, or extent of type I interferon production. Type I interferons include the interferon-alpha, beta, delta, episilon, zeta, kappa, tau, and omega gene families.
	GO:0060340	positive regulation of type I interferon-mediated signaling pathway	Any process that increases the rate, frequency or extent of a type I interferon-mediated signaling pathway. A type I interferon-mediated signaling pathway is the series of molecular events generated as a consequence of a type I interferon binding to a cell surface receptor.
	GO:0097300	programmed necrotic cell death	A necrotic cell death process that results from the activation of endogenous cellular processes, such as signaling involving death domain receptors or Toll-like receptors.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0009617	response to bacterium	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus from a bacterium.
	GO:0043330	response to exogenous dsRNA	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an exogenous double-stranded RNA stimulus.
	GO:0032496	response to lipopolysaccharide	Any process that results in a change in state or activity of an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipopolysaccharide stimulus; lipopolysaccharide is a major component of the cell wall of gram-negative bacteria.
	GO:0006366	transcription from RNA polymerase II promoter	The synthesis of RNA from a DNA template by RNA polymerase II, originating at an RNA polymerase II promoter. Includes transcription of messenger RNA (mRNA) and certain small nuclear RNAs (snRNAs).
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
	GO:0045351	type I interferon biosynthetic process	The chemical reactions and pathways resulting in the formation of any type I interferon. Type I interferons include the interferon-alpha, beta, delta, episilon, zeta, kappa, tau, and omega gene families.
	GO:0060337	type I interferon signaling pathway	A series of molecular signals initiated by the binding of a type I interferon to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription. Type I interferons include the interferon-alpha, beta, delta, episilon, zeta, kappa, tau, and omega gene families.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2o6g)

	Sites
(no "Sites" information available for 2o6g)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2o6g)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2o6g
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	IRF3_HUMAN \| Q14653
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	IRF3_HUMAN \| Q14653
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	IRF3_HUMAN \| Q14653	:	1j2f 1qwt 1t2k 1zoq 2o61 2pi0 3a77 3qu6 5jej 5jek 5jel 5jem 5jeo 5jer

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 8)

PROSITE Motifs (2, 8)

Exons (2, 8)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (1, 4)

Pfam Domains (1, 4)

Gene Ontology (43, 43)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File