Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF TETR-FAMILY REGULATOR (SCO0857) FROM STREPTOMYCES COELICOLOR A3.
 
Authors :  K. D. Koclega, X. Xu, M. Chruszcz, J. Gu, M. Cymborowski, A. Savchenko, A A. Joachimiak, W. Minor, Midwest Center For Structural Genomics
Date :  26 Oct 06  (Deposition) - 28 Nov 06  (Release) - 05 Oct 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.35
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Tetr, Transcriptional Regulator, Structural Genomics, Psi-2, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg, Transcription (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  K. D. Koclega, X. Xu, M. Chruszcz, J. Gu, M. Cymborowski, A. Savchenko, A. Edwards, W. Minor, Midwest Center For Structural Genomics (Mcsg)
Crystal Structure Of Tetr-Family Regulator (Sco0857) From Streptomyces Coelicolor A3.
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PUTATIVE TETR-FAMILY REGULATOR
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: P15TV LIC
    Expression System Strain: BL21 DE3 STAR MAGIC
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: SCO0857
    Organism Scientific: STREPTOMYCES COELICOLOR
    Organism Taxid: 1902

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 12)

Asymmetric/Biological Unit (1, 12)
No.NameCountTypeFull Name
1MSE12Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 2NP3)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2NP3)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Glu A:186 -Pro A:187
2Glu B:186 -Pro B:187

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2NP3)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2NP3)

(-) Exons   (0, 0)

(no "Exon" information available for 2NP3)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:143
 aligned with Q9RCV4_STRCO | Q9RCV4 from UniProtKB/TrEMBL  Length:212

    Alignment length:177
                                    44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       
         Q9RCV4_STRCO    35 ILTAARVCFAERGFDATSLRRIAETAGVDQSLVHHFYGTKENLFLQALELPGKIEEAITAAAQGGLDGIGERVVRAHLSVWDDVSSRPALMTMVRSAAIHRAAAARLRETATGILARALGGVITGEDAMLRTSMVATQLVGLAMMRYVAHLEPLASADTDTVARHYGRAVQAIVTDR 211
               SCOP domains d2np3a1 A                           :35-99                       d2np3a2 A:100-211 Putative tran       scriptional regulator SCO0857                                              SCOP domains
               CATH domains 2np3A00 A                           :35-211 Tetracycline Repressor, domain 2                                                                                                      CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhh---------------------------....hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh-------hhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2np3 A  35 ILTAARVCF---------------------------YGTKENLFLQALELPGKIEEAITAAAQGGLDGIGERVVRAHLSVWDDVSSRPALmTmVRS-------AARLRETATGILARALGGVITGEDAmLRTSmVATQLVGLAmmRYVAHLEPLASADTDTVARHYGRAVQAIVTDR 211
                                    |-         -         -      | 74        84        94       104       114       124| |  |   -   |   144       154       164   |   174   ||  184       194       204       
                                   43                          71                                                   125-MSE|     138                      163-MSE|       178-MSE                             
                                                                                                                      127-MSE                                  168-MSE    179-MSE                            
                                                                                                                         130                                                                                 


Chain B from PDB  Type:PROTEIN  Length:180
 aligned with Q9RCV4_STRCO | Q9RCV4 from UniProtKB/TrEMBL  Length:212

    Alignment length:189
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201         
         Q9RCV4_STRCO    22 GGRRPGETRTREAILTAARVCFAERGFDATSLRRIAETAGVDQSLVHHFYGTKENLFLQALELPGKIEEAITAAAQGGLDGIGERVVRAHLSVWDDVSSRPALMTMVRSAAIHRAAAARLRETATGILARALGGVITGEDAMLRTSMVATQLVGLAMMRYVAHLEPLASADTDTVARHYGRAVQAIVTD 210
               SCOP domains d2np3b1 B:22-99 Putative transcriptional regulator SCO0857                    d2np3b2 B:100-210 Putative trans         criptional regulator SCO0857                                           SCOP domains
               CATH domains 2np3B01 B:22-82 Homeodomain-like                             2np3B02 B:83-210 Tetracycline Repressor, domain 2                                                                                CATH domains
           Pfam domains (1) -------------TetR_N-2np3B01 B:35-81                         --------------------------------------------------------------------------------------------------------------------------------- Pfam domains (1)
           Pfam domains (2) -------------TetR_N-2np3B02 B:35-81                         --------------------------------------------------------------------------------------------------------------------------------- Pfam domains (2)
         Sec.struct. author .....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh---------hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2np3 B  22 GGRRPGETRTREAILTAARVCFAERGFDATSLRRIAETAGVDQSLVHHFYGTKENLFLQALELPGKIEEAITAAAQGGLDGIGERVVRAHLSVWDDVSSRPALmTmVRSA---------LRETATGILARALGGVITGEDAmLRTSmVATQLVGLAmmRYVAHLEPLASADTDTVARHYGRAVQAIVTD 210
                                    31        41        51        61        71        81        91       101       111       121   | | 131       141       151       161 |    |171      |181       191       201         
                                                                                                                                 125-MSE31       141                   163-MSE|       178-MSE                            
                                                                                                                                   127-MSE                                  168-MSE    179-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 4)

Asymmetric/Biological Unit
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (2, 3)

Asymmetric/Biological Unit
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: HTH (544)

(-) Gene Ontology  (3, 3)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Q9RCV4_STRCO | Q9RCV4)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
biological process
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 2np3)
 
  Cis Peptide Bonds
    Glu A:186 - Pro A:187   [ RasMol ]  
    Glu B:186 - Pro B:187   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2np3
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9RCV4_STRCO | Q9RCV4
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q9RCV4_STRCO | Q9RCV4
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2NP3)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2NP3)