Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF IL1A-S100A13 COMPLEX
 
Authors :  S. K. Mohan, C. Yu
Date :  09 Nov 10  (Deposition) - 26 Jan 11  (Release) - 13 Jan 16  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A,B,C,D  (20x)
NMR Structure *:  A,B,C,D  (1x)
Keywords :  Protein-Protein Complex, Key Component In Non-Classical Pathway Of Il-1A, Interleukin-1Alpha, S100A13, Cytokine-Transport Protein Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. K. Mohan, C. Yu
The Il1Alpha-S100A13 Heterotetrameric Complex Structure: A Component In The Non-Classical Pathway For Interleukin 1Alpha Secretion
J. Biol. Chem. V. 286 14608 2011
PubMed-ID: 21270123  |  Reference-DOI: 10.1074/JBC.M110.201954

(-) Compounds

Molecule 1 - INTERLEUKIN-1 ALPHA
    Chains: A, D
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: BL21DE3
    Expression System Taxid: 562
    Expression System Vector: PET20
    Expression System Vector Type: VECTOR
    Fragment: RESIDUES 121-271
    Gene: IL1A, IL1F1
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: IL-1 ALPHA, HEMATOPOIETIN-1
 
Molecule 2 - PROTEIN S100-A13
    Chains: B, C
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: BL21DE3
    Expression System Taxid: 562
    Expression System Vector: PGEX-4T1
    Expression System Vector Type: VECTOR
    Gene: S100A13
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: S100 CALCIUM-BINDING PROTEIN A13

 Structural Features

(-) Chains, Units

  1234
NMR Structure (20x): ABCD
NMR Structure * (1x): ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2L5X)

(-) Sites  (0, 0)

(no "Site" information available for 2L5X)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2L5X)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2L5X)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (3, 6)

NMR Structure (3, 6)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_014600N125DIL1A_HUMANPolymorphism17562A/DN13D
2UniProtVAR_014306D138NIL1A_HUMANPolymorphism3783581A/DD26N
3UniProtVAR_014601D176HIL1A_HUMANPolymorphism1801715A/DD64H
  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
NMR Structure * (3, 6)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_014600N125DIL1A_HUMANPolymorphism17562A/DN13D
2UniProtVAR_014306D138NIL1A_HUMANPolymorphism3783581A/DD26N
3UniProtVAR_014601D176HIL1A_HUMANPolymorphism1801715A/DD64H
  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 2)

NMR Structure (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1INTERLEUKIN_1PS00253 Interleukin-1 signature.IL1A_HUMAN234-254
 		  2A:122-142
D:122-142
NMR Structure * (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1INTERLEUKIN_1PS00253 Interleukin-1 signature.IL1A_HUMAN234-254
 		  2A:122-142
D:122-142

(-) Exons   (5, 10)

NMR Structure (5, 10)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000002633391ENSE00001325622chr2:113542167-113542020148IL1A_HUMAN-00--
1.2ENST000002633392ENSE00001128612chr2:113541355-11354130155IL1A_HUMAN1-16160--
1.3ENST000002633393ENSE00001145252chr2:113540341-11354029349IL1A_HUMAN16-32170--
1.4ENST000002633394ENSE00000856832chr2:113539403-113539181223IL1A_HUMAN33-107750--
1.5ENST000002633395ENSE00000773893chr2:113537243-113537073171IL1A_HUMAN107-164582A:9-52
D:9-52		44
44
1.6ENST000002633396ENSE00000773892chr2:113535688-113535564125IL1A_HUMAN164-205422A:52-93
D:52-93		42
42
1.7ENST000002633397ENSE00001128606chr2:113532844-1135314921353IL1A_HUMAN206-271662A:94-159
D:94-159		66
66
2.9fENST000003926239fENSE00001512519chr1:153599744-153599615130S10AD_HUMAN-00--
2.9jENST000003926239jENSE00002186841chr1:153599009-153598796214S10AD_HUMAN1-51512B:1-51
C:1-51		51
51
2.10bENST0000039262310bENSE00001364911chr1:153591514-153591280235S10AD_HUMAN52-98472B:52-98
C:52-98		47
47

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:151
 aligned with IL1A_HUMAN | P01583 from UniProtKB/Swiss-Prot  Length:271

    Alignment length:151
                                   130       140       150       160       170       180       190       200       210       220       230       240       250       260       270 
           IL1A_HUMAN   121 NVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA 271
               SCOP domains d2l5xa_ A: automated matches                                                                                                                            SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeee......ee......eee.....eee...........eeeeeee........eeeeee....eee..........eee......ee.......eeeeeee..eeeeee...........................eee..... Sec.struct. author
                 SAPs(SNPs) ----D------------N-------------------------------------H----------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------INTERLEUKIN_1        ----------------- PROSITE
           Transcript 1 (1) Exon 1.5  PDB: A:9-52 UniProt: 107-164      -----------------------------------------Exon 1.7  PDB: A:94-159 UniProt: 206-271                           Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------Exon 1.6  PDB: A:52-93 UniProt: 164-205   ------------------------------------------------------------------ Transcript 1 (2)
                 2l5x A   9 NVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA 159
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158 


Chain B from PDB  Type:PROTEIN  Length:98
 aligned with S10AD_HUMAN | Q99584 from UniProtKB/Swiss-Prot  Length:98

    Alignment length:98
                                    10        20        30        40        50        60        70        80        90        
          S10AD_HUMAN     1 MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK  98
               SCOP domains d2l5xb_ B: automated matches                                                                       SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhh..........hhhhhhhhhh..........hhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------- PROSITE
               Transcript 2 Exon 2.9j  PDB: B:1-51 UniProt: 1-51               Exon 2.10b  PDB: B:52-98 UniProt: 52-98         Transcript 2
                 2l5x B   1 MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK  98
                                    10        20        30        40        50        60        70        80        90        


Chain C from PDB  Type:PROTEIN  Length:98
 aligned with S10AD_HUMAN | Q99584 from UniProtKB/Swiss-Prot  Length:98

    Alignment length:98
                                    10        20        30        40        50        60        70        80        90        
          S10AD_HUMAN     1 MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK  98
               SCOP domains d2l5xc_ C: automated matches                                                                       SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) --------S_100-2l5xC01 C:9-52                        ---------------------------------------------- Pfam domains (1)
           Pfam domains (2) --------S_100-2l5xC02 C:9-52                        ---------------------------------------------- Pfam domains (2)
         Sec.struct. author ......hhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhh..........hhhhhhhhhh..........hhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------- PROSITE
               Transcript 2 Exon 2.9j  PDB: C:1-51 UniProt: 1-51               Exon 2.10b  PDB: C:52-98 UniProt: 52-98         Transcript 2
                 2l5x C   1 MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK  98
                                    10        20        30        40        50        60        70        80        90        


Chain D from PDB  Type:PROTEIN  Length:151
 aligned with IL1A_HUMAN | P01583 from UniProtKB/Swiss-Prot  Length:271

    Alignment length:151
                                   130       140       150       160       170       180       190       200       210       220       230       240       250       260       270 
           IL1A_HUMAN   121 NVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA 271
               SCOP domains d2l5xd_ D: automated matches                                                                                                                            SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ----------------------------------IL1-2l5xD01 D:43-154                                                                                            ----- Pfam domains (1)
           Pfam domains (2) ----------------------------------IL1-2l5xD02 D:43-154                                                                                            ----- Pfam domains (2)
         Sec.struct. author ...eeeeee......ee......eee.....eee...........eeeeeee........eeeeee....eeee........eeee......ee.......eeeeeee..eeeeee...........................eee..... Sec.struct. author
                 SAPs(SNPs) ----D------------N-------------------------------------H----------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------INTERLEUKIN_1        ----------------- PROSITE
           Transcript 1 (1) Exon 1.5  PDB: D:9-52 UniProt: 107-164      -----------------------------------------Exon 1.7  PDB: D:94-159 UniProt: 206-271                           Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------Exon 1.6  PDB: D:52-93 UniProt: 164-205   ------------------------------------------------------------------ Transcript 1 (2)
                 2l5x D   9 NVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA 159
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 4)

NMR Structure
(-)
Class: All alpha proteins (14657)
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2L5X)

(-) Pfam Domains  (2, 4)

NMR Structure
(-)
Clan: EF_hand (270)
(-)
Clan: Trefoil (131)
(-)
Family: IL1 (17)
(-)
Homo sapiens (Human) (14)
2aIL1-2l5xD01D:43-154
2bIL1-2l5xD02D:43-154

(-) Gene Ontology  (51, 58)

NMR Structure(hide GO term definitions)
Chain A,D   (IL1A_HUMAN | P01583)
molecular function
    GO:0005507    copper ion binding    Interacting selectively and non-covalently with copper (Cu) ions.
    GO:0005125    cytokine activity    Functions to control the survival, growth, differentiation and effector function of tissues and cells.
    GO:0005149    interleukin-1 receptor binding    Interacting selectively and non-covalently with the interleukin-1 receptor.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0006915    apoptotic process    A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
    GO:0008283    cell proliferation    The multiplication or reproduction of cells, resulting in the expansion of a cell population.
    GO:0034605    cellular response to heat    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a heat stimulus, a temperature stimulus above the optimal temperature for that organism.
    GO:0002248    connective tissue replacement involved in inflammatory response wound healing    The series of events leading to growth of connective tissue when loss of tissues that are incapable of regeneration occurs, or when fibrinous exudate cannot be adequately cleared that contribute to an inflammatory response.
    GO:0019221    cytokine-mediated signaling pathway    A series of molecular signals initiated by the binding of a cytokine to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0035234    ectopic germ cell programmed cell death    Programmed cell death of an errant germ line cell that is outside the normal migratory path or ectopic to the gonad. This is an important mechanism of regulating germ cell survival within the embryo.
    GO:0097192    extrinsic apoptotic signaling pathway in absence of ligand    A series of molecular signals in which a signal is conveyed from the cell surface to trigger the apoptotic death of a cell. The pathway starts with withdrawal of a ligand from a cell surface receptor, and ends when the execution phase of apoptosis is triggered.
    GO:0001660    fever generation    The heat generation process that results in a rise in body temperature above the normal, often as a response to infection.
    GO:0006955    immune response    Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
    GO:0006954    inflammatory response    The immediate defensive reaction (by vertebrate tissue) to infection or injury caused by chemical or physical agents. The process is characterized by local vasodilation, extravasation of plasma into intercellular spaces and accumulation of white blood cells and macrophages.
    GO:0008285    negative regulation of cell proliferation    Any process that stops, prevents or reduces the rate or extent of cell proliferation.
    GO:2001240    negative regulation of extrinsic apoptotic signaling pathway in absence of ligand    Any process that stops, prevents or reduces the frequency, rate or extent of extrinsic apoptotic signaling pathway in absence of ligand.
    GO:0043123    positive regulation of I-kappaB kinase/NF-kappaB signaling    Any process that activates or increases the frequency, rate or extent of I-kappaB kinase/NF-kappaB signaling.
    GO:0046330    positive regulation of JNK cascade    Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the JNK cascade.
    GO:0045766    positive regulation of angiogenesis    Any process that activates or increases angiogenesis.
    GO:0051781    positive regulation of cell division    Any process that activates or increases the frequency, rate or extent of cell division.
    GO:0050715    positive regulation of cytokine secretion    Any process that activates or increases the frequency, rate or extent of the regulated release of cytokines from a cell.
    GO:0010628    positive regulation of gene expression    Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
    GO:0045086    positive regulation of interleukin-2 biosynthetic process    Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of interleukin-2.
    GO:0045840    positive regulation of mitotic nuclear division    Any process that activates or increases the frequency, rate or extent of mitosis.
    GO:0050714    positive regulation of protein secretion    Any process that activates or increases the frequency, rate or extent of the controlled release of a protein from a cell.
    GO:0045944    positive regulation of transcription from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0010575    positive regulation of vascular endothelial growth factor production    Any process that increases or activates the frequency, rate, or extent of production of vascular endothelial growth factor.
    GO:0046688    response to copper ion    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a copper ion stimulus.
cellular component
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.

Chain B,C   (S10AD_HUMAN | Q99584)
molecular function
    GO:0050786    RAGE receptor binding    Interacting selectively and non-covalently with the RAGE receptor, the receptor for advanced glycation end-products.
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0005507    copper ion binding    Interacting selectively and non-covalently with copper (Cu) ions.
    GO:0017134    fibroblast growth factor binding    Interacting selectively and non-covalently with a fibroblast growth factor.
    GO:0008289    lipid binding    Interacting selectively and non-covalently with a lipid.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0042803    protein homodimerization activity    Interacting selectively and non-covalently with an identical protein to form a homodimer.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0050663    cytokine secretion    The regulated release of cytokines from a cell. Cytokines are any of a group of proteins that function to control the survival, growth and differentiation of tissues and cells, and which have autocrine and paracrine activity.
    GO:0050703    interleukin-1 alpha secretion    The regulated release of interleukin-1 alpha from a cell.
    GO:0043303    mast cell degranulation    The regulated exocytosis of secretory granules containing preformed mediators such as histamine, serotonin, and neutral proteases by a mast cell.
    GO:0043123    positive regulation of I-kappaB kinase/NF-kappaB signaling    Any process that activates or increases the frequency, rate or extent of I-kappaB kinase/NF-kappaB signaling.
    GO:0008284    positive regulation of cell proliferation    Any process that activates or increases the rate or extent of cell proliferation.
    GO:0015031    protein transport    The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0008360    regulation of cell shape    Any process that modulates the surface configuration of a cell.
    GO:0046688    response to copper ion    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a copper ion stimulus.
    GO:0051602    response to electrical stimulus    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an electrical stimulus.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0042629    mast cell granule    Coarse, bluish-black staining cytoplasmic granules, bounded by a plasma membrane and found in mast cells and basophils. Contents include histamine, heparin, chondroitin sulfates, chymase and tryptase.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0048471    perinuclear region of cytoplasm    Cytoplasm situated near, or occurring around, the nucleus.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2l5x)
 
  Sites
(no "Sites" information available for 2l5x)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2l5x)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2l5x
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  IL1A_HUMAN | P01583
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  S10AD_HUMAN | Q99584
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  IL1A_HUMAN | P01583
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  S10AD_HUMAN | Q99584
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        IL1A_HUMAN | P01583: 1ita 2ila 2kki
        S10AD_HUMAN | Q99584: 1yur 1yus 1yut 1yuu 2egd 2h2k 2k8m 2ki4 2ki6 2kot 2le9

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2L5X)