Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF THE R2R3 DNA BINDING DOMAIN OF MYB1 PROTEIN FROM PROTOZOAN PARASITE TRICHOMONAS VAGINALIS IN COMPLEX WITH MRE-1/MRE-2R DNA
 
Authors :  Y. C. Lou, S. Y. Wei, M. Rajasekaran, C. C. Chou, H. M. Hsu, J. H. Tai, C. Chen
Date :  21 Jan 09  (Deposition) - 17 Mar 09  (Release) - 17 Mar 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A,B,C  (10x)
Keywords :  Myb1, R2R3 Domain, Dna-Binding, Nucleus, Transcription/Dna Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Y. C. Lou, S. Y. Wei, M. Rajasekaran, C. C. Chou, H. M. Hsu, J. H. Tai, C. Chen
Nmr Structural Analysis Of Dna Recognition By A Novel Myb1 Dna-Binding Domain In The Protozoan Parasite Trichomonas Vaginalis.
Nucleic Acids Res. 2009
PubMed-ID: 19246540  |  Reference-DOI: 10.1093/NAR/GKP097
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - MYB24
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 562
    Expression System Vector: PET29B
    Expression System Vector Type: VECTOR
    Fragment: MYB1 R2R3 DOMAIN
    Organism Scientific: TRICHOMONAS VAGINALIS
    Organism Taxid: 5722
    Strain: T1
 
Molecule 2 - 5'- D(*AP*AP*GP*AP*TP*AP*AP*CP*GP*AP*TP*AP*TP*TP*TP*A)-3'
    Chains: B
    Engineered: YES
    Synthetic: YES
 
Molecule 3 - 5'- D(*TP*AP*AP*AP*TP*AP*TP*CP*GP*TP*TP*AP*TP*CP*TP*T)-3'
    Chains: C
    Engineered: YES
    Synthetic: YES

 Structural Features

(-) Chains, Units

  
NMR Structure (10x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2KDZ)

(-) Sites  (0, 0)

(no "Site" information available for 2KDZ)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2KDZ)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2KDZ)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2KDZ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2KDZ)

(-) Exons   (0, 0)

(no "Exon" information available for 2KDZ)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:107
 aligned with Q58HP2_TRIVA | Q58HP2 from UniProtKB/TrEMBL  Length:206

    Alignment length:107
                                    44        54        64        74        84        94       104       114       124       134       
         Q58HP2_TRIVA    35 KVKFTEEEDLKLQQLVMRYGAKDWIRISQLMITRNPRQCRERWNNYINPALRTDPWSPEEDMLLDQKYAEYGPKWNKISKFLKNRSDNNIRNRWMMIARHRAKHQKS 141
               SCOP domains d2kdza1 A:1-49 automated matches                 d2kdza2 A:50-107 automated matches                         SCOP domains
               CATH domains 2kdzA01 A:1-53 Homeodomain-like                      2kdzA02 A:54-107 Homeodomain-like                      CATH domains
               Pfam domains ---Myb_DNA-bind_6-2kdzA01 A:4-64                                ------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhh..hhhhhh......hhhhhhhhhhhhh.........hhhhhhhhhhhhhh...hhhhhh......hhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------- Transcript
                 2kdz A   1 KVKFTEEEDLKLQQLVMRYGAKDWIRISQLMITRNPRQCRERWNNYINPALRTDPWSPEEDMLLDQKYAEYGPKWNKISKFLKNRSDNNIRNRWMMIARHRAKHQKS 107
                                    10        20        30        40        50        60        70        80        90       100       


Chain B from PDB  Type:DNA  Length:16
                                                
                 2kdz B   1 AAGATAACGATATTTA  16
                                    10      


Chain C from PDB  Type:DNA  Length:16
                                                
                 2kdz C  17 TAAATATCGTTATCTT  32
                                    26
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

NMR Structure
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (1, 2)

NMR Structure
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: HTH (544)

(-) Gene Ontology  (1, 1)

NMR Structure(hide GO term definitions)
Chain A   (Q58HP2_TRIVA | Q58HP2)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2kdz)
 
  Sites
(no "Sites" information available for 2kdz)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2kdz)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2kdz
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q58HP2_TRIVA | Q58HP2
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q58HP2_TRIVA | Q58HP2
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q58HP2_TRIVA | Q58HP2: 2k9n

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2KDZ)