Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE GTPASE BINDING DOMAIN OF WASP IN COMPLEX WITH ESPFU, AN EHEC EFFECTOR
 
Authors :  H. -C. Cheng, B. M. Skehan, K. G. Campellone, J. M. Leong, M. K. Rosen
Date :  27 May 08  (Deposition) - 22 Jul 08  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A,B  (20x)
Keywords :  Wasp, Espfu, Gbd, Autoinhibition, Cytoplasm, Cytoskeleton, Disease Mutation, Phosphoprotein, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  H. C. Cheng, B. M. Skehan, K. G. Campellone, J. M. Leong, M. K. Rosen
Structural Mechanism Of Wasp Activation By The Enterohaemorrhagic E. Coli Effector Espf(U).
Nature V. 454 1009 2008
PubMed-ID: 18650809  |  Reference-DOI: 10.1038/NATURE07160
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - WISKOTT-ALDRICH SYNDROME PROTEIN
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL21 (DE3)
    Expression System VectorPGEX
    FragmentCRIB DOMAIN, UNP RESIDUES 242-310
    GeneWAS, IMD2
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymWASP
 
Molecule 2 - ESPFU
    ChainsB
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL21 (DE3)
    Expression System VectorPGEX
    FragmentUNP RESIDUES 268-300
    GeneTCCP, ECS2715
    Organism Taxid83334
    SynonymTIR-CYTOSKELETON COUPLING PROTEIN

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2K42)

(-) Sites  (0, 0)

(no "Site" information available for 2K42)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2K42)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2K42)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (1, 1)

NMR Structure (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_033256L270PWASP_HUMANDisease (XLN)28936079AL32P

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2K42)

(-) Exons   (3, 3)

NMR Structure (3, 3)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.3aENST000003767013aENSE00001707442X:48542168-48542374207WASP_HUMAN1-44440--
1.4ENST000003767014ENSE00000669941X:48542672-48542812141WASP_HUMAN45-91470--
1.5ENST000003767015ENSE00000332766X:48543936-4854402287WASP_HUMAN92-120290--
1.6aENST000003767016aENSE00000332767X:48544123-48544225103WASP_HUMAN121-155350--
1.7ENST000003767017ENSE00000669945X:48544335-4854437642WASP_HUMAN155-169150--
1.8ENST000003767018ENSE00000669947X:48544470-4854452354WASP_HUMAN169-187190--
1.9bENST000003767019bENSE00000332770X:48545170-48545344175WASP_HUMAN187-245591A:1-77
1.10aENST0000037670110aENSE00000332771X:48546443-4854648543WASP_HUMAN245-259151A:7-2115
1.11bENST0000037670111bENSE00000669950X:48546689-48546842154WASP_HUMAN260-311521A:22-7251
1.12bENST0000037670112bENSE00001255082X:48547049-48547455407WASP_HUMAN311-4461360--
1.13aENST0000037670113aENSE00000867103X:48547709-48547823115WASP_HUMAN447-485390--
1.14ENST0000037670114ENSE00000867104X:48549498-48549818321WASP_HUMAN485-502180--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:72
 aligned with WASP_HUMAN | P42768 from UniProtKB/Swiss-Prot  Length:502

    Alignment length:72
                                   248       258       268       278       288       298       308  
           WASP_HUMAN   239 GAPSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGLEAVRQEMRRQ 310
               SCOP domains ------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------ CATH domains
               Pfam domains ---PBD-2k42A01 A:4-58                                     -------------- Pfam domains
         Sec.struct. author .............ee...ee.....hhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------P---------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) ------Exon 1.10a     Exon 1.11b  PDB: A:22-72 UniProt: 260-311           Transcript 1 (1)
           Transcript 1 (2) 1.9b   ----------------------------------------------------------------- Transcript 1 (2)
                 2k42 A   1 GHMSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGLEAVRQEMRRQ  72
                                    10        20        30        40        50        60        70  

Chain B from PDB  Type:PROTEIN  Length:36
 aligned with A0A0H3JD26_E | A0A0H3JD26 from UniProtKB/TrEMBL  Length:189

    Alignment length:56
                                   106       116       126       136       146      
         A0A0H3JD26_E    97 EHIPPAPNWPAPTPPVQNEQSRPLPDVAQRLMQHLAEHGIQPARNMAEHIPPAPNW 152
               SCOP domains -------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------- Pfam domains
         Sec.struct. author ...--------------------..hhhhhhhhhhhh................... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------- Transcript
                 2k42 B  73 GHM--------------------LPDVAQRLMQHLAEHGIQPARNMAEHIPPAPNW 108
                              |      -         -   |    82        92       102      
                             75                   76                                

Chain B from PDB  Type:PROTEIN  Length:36
 aligned with ESFU2_ECO57 | P0DJ88 from UniProtKB/Swiss-Prot  Length:337

    Alignment length:56
                                   207       217       227       237       247      
          ESFU2_ECO57   198 EHIPPAPNWPAPPPPVQNEQSRPLPDVAQRLMQHLAEHGIQPARNMAEHIPPAPNW 253
               SCOP domains -------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------- Pfam domains
         Sec.struct. author ...--------------------..hhhhhhhhhhhh................... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------- Transcript
                 2k42 B  73 GHM--------------------LPDVAQRLMQHLAEHGIQPARNMAEHIPPAPNW 108
                              |      -         -   |    82        92       102      
                             75                   76                                

Chain B from PDB  Type:PROTEIN  Length:36
 aligned with ESFU3_ECO57 | P0DJ89 from UniProtKB/Swiss-Prot  Length:337

    Alignment length:56
                                   207       217       227       237       247      
          ESFU3_ECO57   198 EHIPPAPNWPAPPPPVQNEQSRPLPDVAQRLMQHLAEHGIQPARNMAEHIPPAPNW 253
               SCOP domains -------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------- Pfam domains
         Sec.struct. author ...--------------------..hhhhhhhhhhhh................... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------- Transcript
                 2k42 B  73 GHM--------------------LPDVAQRLMQHLAEHGIQPARNMAEHIPPAPNW 108
                              |      -         -   |    82        92       102      
                             75                   76                                

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2K42)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2K42)

(-) Pfam Domains  (1, 1)

NMR Structure

(-) Gene Ontology  (34, 37)

NMR Structure(hide GO term definitions)
Chain A   (WASP_HUMAN | P42768)
molecular function
    GO:0030695    GTPase regulator activity    Modulates the rate of GTP hydrolysis by a GTPase.
    GO:0017124    SH3 domain binding    Interacting selectively and non-covalently with a SH3 domain (Src homology 3) of a protein, small protein modules containing approximately 50 amino acid residues found in a great variety of intracellular or membrane-associated proteins.
    GO:0003779    actin binding    Interacting selectively and non-covalently with monomeric or multimeric forms of actin, including actin filaments.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0043274    phospholipase binding    Interacting selectively and non-covalently with any phospholipase, enzymes that catalyze of the hydrolysis of a glycerophospholipid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0019901    protein kinase binding    Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
biological process
    GO:0038096    Fc-gamma receptor signaling pathway involved in phagocytosis    An Fc-gamma receptor signaling pathway that contributes to the endocytic engulfment of external particulate material by phagocytes.
    GO:0042110    T cell activation    The change in morphology and behavior of a mature or immature T cell resulting from exposure to a mitogen, cytokine, chemokine, cellular ligand, or an antigen for which it is specific.
    GO:0050852    T cell receptor signaling pathway    A series of molecular signals initiated by the cross-linking of an antigen receptor on a T cell.
    GO:0007015    actin filament organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments. Includes processes that control the spatial distribution of actin filaments, such as organizing filaments into meshworks, bundles, or other structures, as by cross-linking.
    GO:0030041    actin filament polymerization    Assembly of actin filaments by the addition of actin monomers to a filament.
    GO:0030048    actin filament-based movement    Movement of organelles or other particles along actin filaments, or sliding of actin filaments past each other, mediated by motor proteins.
    GO:0008154    actin polymerization or depolymerization    Assembly or disassembly of actin filaments by the addition or removal of actin monomers from a filament.
    GO:0007596    blood coagulation    The sequential process in which the multiple coagulation factors of the blood interact, ultimately resulting in the formation of an insoluble fibrin clot; it may be divided into three stages: stage 1, the formation of intrinsic and extrinsic prothrombin converting principle; stage 2, the formation of thrombin; stage 3, the formation of stable fibrin polymers.
    GO:0006952    defense response    Reactions, triggered in response to the presence of a foreign body or the occurrence of an injury, which result in restriction of damage to the organism attacked or prevention/recovery from the infection caused by the attack.
    GO:0016197    endosomal transport    The directed movement of substances into, out of, or mediated by an endosome, a membrane-bounded organelle that carries materials newly ingested by endocytosis. It passes many of the materials to lysosomes for degradation.
    GO:0008544    epidermis development    The process whose specific outcome is the progression of the epidermis over time, from its formation to the mature structure. The epidermis is the outer epithelial layer of an animal, it may be a single layer that produces an extracellular material (e.g. the cuticle of arthropods) or a complex stratified squamous epithelium, as in the case of many vertebrate species.
    GO:0006955    immune response    Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
    GO:2000146    negative regulation of cell motility    Any process that stops, prevents, or reduces the frequency, rate or extent of cell motility.
    GO:2000601    positive regulation of Arp2/3 complex-mediated actin nucleation    Any process that activates or increases the frequency, rate or extent of Arp2/3 complex-mediated actin nucleation.
    GO:0006461    protein complex assembly    The aggregation, arrangement and bonding together of a set of components to form a protein complex.
    GO:0002625    regulation of T cell antigen processing and presentation    Any process that modulates the frequency, rate, or extent of T cell antigen processing and presentation.
    GO:0050790    regulation of catalytic activity    Any process that modulates the activity of an enzyme.
cellular component
    GO:0015629    actin cytoskeleton    The part of the cytoskeleton (the internal framework of a cell) composed of actin and associated proteins. Includes actin cytoskeleton-associated complexes.
    GO:0005911    cell-cell junction    A cell junction that forms a connection between two or more cells in a multicellular organism; excludes direct cytoplasmic junctions such as ring canals.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005856    cytoskeleton    Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0012506    vesicle membrane    The lipid bilayer surrounding any membrane-bounded vesicle in the cell.

Chain B   (ESFU2_ECO57 | P0DJ88)
biological process
    GO:0009405    pathogenesis    The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0030430    host cell cytoplasm    The cytoplasm of a host cell.

Chain B   (A0A0H3JD26_E | A0A0H3JD26)

Chain B   (ESFU3_ECO57 | P0DJ89)
biological process
    GO:0009405    pathogenesis    The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0030430    host cell cytoplasm    The cytoplasm of a host cell.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2k42)
 
  Sites
(no "Sites" information available for 2k42)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2k42)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2k42
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A0A0H3JD26_E | A0A0H3JD26
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
  ESFU2_ECO57 | P0DJ88
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  ESFU3_ECO57 | P0DJ89
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  WASP_HUMAN | P42768
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  300299
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  A0A0H3JD26_E | A0A0H3JD26
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  ESFU2_ECO57 | P0DJ88
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  ESFU3_ECO57 | P0DJ89
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  WASP_HUMAN | P42768
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ESFU2_ECO57 | P0DJ882kxc
        ESFU3_ECO57 | P0DJ892kxc 2lnh
        WASP_HUMAN | P427681cee 1ej5 1t84 2a3z 2ot0

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2K42)