Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STURCTURE OF HUMAN MEKK3 PB1 DOMAIN CIS ISOMER
 
Authors :  H. Qi, Z. Jiahai, W. Jihui, S. Yunyu
Date :  26 Jun 07  (Deposition) - 10 Jul 07  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Kinase Signaling Domain, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Q. Hu, W. Shen, H. Huang, J. Liu, J. Zhang, X. Huang, J. Wu, Y. Shi
Insight Into The Binding Properties Of Mekk3 Pb1 To Mek5 Pb1 From Its Solution Structure.
Biochemistry V. 46 13478 2007
PubMed-ID: 17985933  |  Reference-DOI: 10.1021/BI701341N
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINASE 3
    ChainsA
    EC Number2.7.11.25
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET22B
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    FragmentOPR, PB1 DOMAIN
    GeneMAP3K3, MAPKKK3, MEKK3
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymMAPK/ERK KINASE KINASE 3, MEK KINASE 3, MEKK 3

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2JRH)

(-) Sites  (0, 0)

(no "Site" information available for 2JRH)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2JRH)

(-) Cis Peptide Bonds  (2, 40)

NMR Structure
No.ModelResidues
11, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20Arg A:21 -Pro A:22
21, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20Gln A:38 -Pro A:39

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2JRH)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PB1PS51745 PB1 domain profile.M3K3_HUMAN44-123  1A:3-82

(-) Exons   (5, 5)

NMR Structure (5, 5)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000003617331ENSE00001428739chr17:61699801-61700123323M3K3_HUMAN1-220--
1.2ENST000003617332ENSE00001257248chr17:61710041-61710162122M3K3_HUMAN2-42411A:1-11
1.4ENST000003617334ENSE00000741937chr17:61723394-6172343441M3K3_HUMAN43-56141A:2-1514
1.5ENST000003617335ENSE00001106004chr17:61729917-61730016100M3K3_HUMAN56-89341A:15-4834
1.6ENST000003617336ENSE00000741940chr17:61735154-61735267114M3K3_HUMAN90-127381A:49-8638
1.7ENST000003617337ENSE00000925304chr17:61744300-61744420121M3K3_HUMAN128-168411A:87-937
1.8ENST000003617338ENSE00001047122chr17:61759126-61759259134M3K3_HUMAN168-212450--
1.9ENST000003617339ENSE00000741943chr17:61762877-6176295074M3K3_HUMAN213-237250--
1.10ENST0000036173310ENSE00000741949chr17:61765887-6176595468M3K3_HUMAN237-260240--
1.11ENST0000036173311ENSE00000857855chr17:61766149-6176624193M3K3_HUMAN260-291320--
1.12ENST0000036173312ENSE00000857856chr17:61766904-61767095192M3K3_HUMAN291-355650--
1.13ENST0000036173313ENSE00000741987chr17:61767624-61767772149M3K3_HUMAN355-404500--
1.14ENST0000036173314ENSE00000741989chr17:61768462-61768593132M3K3_HUMAN405-448440--
1.15ENST0000036173315ENSE00000741993chr17:61769093-61769222130M3K3_HUMAN449-492440--
1.16ENST0000036173316ENSE00001601451chr17:61769602-61769779178M3K3_HUMAN492-551600--
1.17ENST0000036173317ENSE00001402070chr17:61770909-617736672759M3K3_HUMAN551-626760--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:93
 aligned with M3K3_HUMAN | Q99759 from UniProtKB/Swiss-Prot  Length:626

    Alignment length:93
                                    51        61        71        81        91       101       111       121       131   
           M3K3_HUMAN    42 QSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILLLSQDRNHNSSSPHS 134
               SCOP domains d2jrha_ A: Mitogen-activated protein kinase kinase kinase 3, MEKK 3                           SCOP domains
               CATH domains 2jrhA00 A:1-93  [code=3.10.20.240, no name defined]                                           CATH domains
               Pfam domains --PB1-2jrhA01 A:3-82                                                              ----------- Pfam domains
         Sec.struct. author ...eeeeeee..eeeeeee....hhhhhhhhhhhhhh..eeeeee....eee..hhhhhhhhhhhhhhh....eeeeeeee............ Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --PB1  PDB: A:3-82 UniProt: 44-123                                                ----------- PROSITE
           Transcript 1 (1) 1Exon 1.4      ---------------------------------Exon 1.6  PDB: A:49-86 UniProt: 90-1271.7     Transcript 1 (1)
           Transcript 1 (2) --------------Exon 1.5  PDB: A:15-48            --------------------------------------------- Transcript 1 (2)
                 2jrh A   1 QSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILLLSQDRNLEHHHHHH  93
                                    10        20        30        40        50        60        70        80        90   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: Ubiquitin (279)

(-) Gene Ontology  (20, 20)

NMR Structure(hide GO term definitions)
Chain A   (M3K3_HUMAN | Q99759)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0004709    MAP kinase kinase kinase activity    Catalysis of the phosphorylation and activation of a MAP kinase kinase; each MAP kinase kinase can be phosphorylated by any of several MAP kinase kinase kinases.
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004672    protein kinase activity    Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
    GO:0004674    protein serine/threonine kinase activity    Catalysis of the reactions: ATP + protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0000165    MAPK cascade    An intracellular protein kinase cascade containing at least a MAPK, a MAPKK and a MAP3K. The cascade can also contain two additional tiers: the upstream MAP4K and the downstream MAP Kinase-activated kinase (MAPKAPK). The kinases in each tier phosphorylate and activate the kinases in the downstream tier to transmit a signal within a cell.
    GO:0000186    activation of MAPKK activity    The initiation of the activity of the inactive enzyme MAP kinase kinase (MAPKK).
    GO:0001568    blood vessel development    The process whose specific outcome is the progression of a blood vessel over time, from its formation to the mature structure. The blood vessel is the vasculature carrying blood.
    GO:0035556    intracellular signal transduction    The process in which a signal is passed on to downstream components within the cell, which become activated themselves to further propagate the signal and finally trigger a change in the function or state of the cell.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:0043123    positive regulation of I-kappaB kinase/NF-kappaB signaling    Any process that activates or increases the frequency, rate or extent of I-kappaB kinase/NF-kappaB signaling.
    GO:1900745    positive regulation of p38MAPK cascade    Any process that activates or increases the frequency, rate or extent of p38MAPK cascade.
    GO:0046777    protein autophosphorylation    The phosphorylation by a protein of one or more of its own amino acid residues (cis-autophosphorylation), or residues on an identical protein (trans-autophosphorylation).
    GO:0006468    protein phosphorylation    The process of introducing a phosphate group on to a protein.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2jrh)
 
  Sites
(no "Sites" information available for 2jrh)
 
  Cis Peptide Bonds
    Arg A:21 - Pro A:22   [ RasMol ]  
    Gln A:38 - Pro A:39   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2jrh
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  M3K3_HUMAN | Q99759
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.11.25
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  M3K3_HUMAN | Q99759
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        M3K3_HUMAN | Q997592c60 2o2v 2pph 4y5o 4yl6

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2JRH)