2J6F - JenaLib

Asym./Biol. Unit - manually (Jmol Viewer)

Asym./Biol. Unit (Jmol Viewer)

Title :   N-TERMINAL SH3 DOMAIN OF CMS (CD2AP HUMAN HOMOLOG) BOUND TO CBL-B PEPTIDE

Authors :   G. Moncalian, N. Cardenes, Y. L. Deribe, M. Spinola-Amilibia, I. Dikic

Date :   28 Sep 06 (Deposition) - 11 Oct 06 (Release) - 05 Jul 17 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.70

Chains :   Asym./Biol. Unit : A,C

Keywords :   Metal-Binding, Immune Response, Sh3, Ligase, Sh2 Domain, Sh3 Domain, Zinc-Finger, Sh3- Binding, Ubl Conjugation Pathway, Cytoskeletal Rearrangements, Phosphorylation, Adaptor Protein, Egfr Downregulation, Cd2 Associated Protein, Protein Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   G. Moncalian, N. Cardenes, Y. L. Deribe, M. Spinola-Amilibia, I. Dikic, J. Bravo
Atypical Polyproline Recognition By The Cms N- Terminal Sh3 Domain.
J. Biol. Chem. V. 281 38845 2006
PubMed-ID: 17020880 | Reference-DOI: 10.1074/JBC.M606411200

Molecule 1 - CD2-ASSOCIATED PROTEIN
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET21A
	Expression System Strain	:	ROSETTA (DE3) PLYS
	Expression System Taxid	:	562
	Fragment	:	SH3, RESIDUES 1-62
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	N-TERMINAL SH3 DOMAIN (SH3A) OF CD2- ASSOCIATED PROTEIN (CD2AP)OR CAS LIGAND WITH MULTIPLE SRC HOMOLOGY 3 DOMAINS (CMS)
	Synonym	:	CAS LIGAND WITH MULTIPLE SH3 DOMAINS, ADAPTER PROTEIN CMS

Molecule 2 - E3 UBIQUITIN-PROTEIN LIGASE CBL-B
	Chains	:	C
	EC Number	:	6.3.2.-
	Engineered	:	YES
	Fragment	:	PEPTIDE, RESIDUES 902-912
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	A.A. 902 TO 912 FROM CAS-BR-M (MURINE) ECTROPIC RETROVIRAL TRANSFORMING SEQUENCE B (CBL-B)
	Synonym	:	CAS-BR-M MURINE ECTROPIC RETROVIRAL TRANSFORMING SEQUENCE B, CBL-B, SIGNAL TRANSDUCTION PROTEIN CBL-B, SH3-BINDING PROTEIN CBL-B, CASITAS B-LINEAGE LYMPHOMA PROTO-ONCOGENE B, RING FINGER PROTEIN 56
	Synthetic	:	YES

		1	2
Asymmetric/Biological Unit	:	A	C

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2J6F)

(no "Site" information available for 2J6F)

(no "SS Bond" information available for 2J6F)

(no "Cis Peptide Bond" information available for 2J6F)

(no "SAP(SNP)/Variant" information available for 2J6F)

(no "PROSITE Motif" information available for 2J6F)

Asymmetric/Biological Unit (4, 4)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.2d	ENST00000264122	2d	ENSE00001340691	chr3:105587887-105587580	308	CBLB_HUMAN	-	0	0	-	-
1.3	ENST00000264122	3	ENSE00002109512	chr3:105586435-105586254	182	CBLB_HUMAN	1-56	56	0	-	-
1.4	ENST00000264122	4	ENSE00002192869	chr3:105572508-105572258	251	CBLB_HUMAN	57-140	84	0	-	-
1.5	ENST00000264122	5	ENSE00001686511	chr3:105495386-105495240	147	CBLB_HUMAN	140-189	50	0	-	-
1.6	ENST00000264122	6	ENSE00001628201	chr3:105470462-105470306	157	CBLB_HUMAN	189-241	53	0	-	-
1.7	ENST00000264122	7	ENSE00001692048	chr3:105464882-105464761	122	CBLB_HUMAN	242-282	41	0	-	-
1.8	ENST00000264122	8	ENSE00001696958	chr3:105459475-105459338	138	CBLB_HUMAN	282-328	47	0	-	-
1.9	ENST00000264122	9	ENSE00001616258	chr3:105456102-105456015	88	CBLB_HUMAN	328-357	30	0	-	-
1.10	ENST00000264122	10	ENSE00001694160	chr3:105452984-105452853	132	CBLB_HUMAN	358-401	44	0	-	-
1.11	ENST00000264122	11	ENSE00001654827	chr3:105439094-105438891	204	CBLB_HUMAN	402-469	68	0	-	-
1.12	ENST00000264122	12	ENSE00001767402	chr3:105423017-105422832	186	CBLB_HUMAN	470-531	62	0	-	-
1.13a	ENST00000264122	13a	ENSE00001607504	chr3:105421303-105420938	366	CBLB_HUMAN	532-653	122	0	-	-
1.14	ENST00000264122	14	ENSE00000774846	chr3:105412432-105412338	95	CBLB_HUMAN	654-685	32	0	-	-
1.15	ENST00000264122	15	ENSE00000774845	chr3:105404310-105404164	147	CBLB_HUMAN	685-734	50	0	-	-
1.16b	ENST00000264122	16b	ENSE00000774844	chr3:105400662-105400568	95	CBLB_HUMAN	734-766	33	0	-	-
1.16d	ENST00000264122	16d	ENSE00000774843	chr3:105400454-105400323	132	CBLB_HUMAN	766-810	45	0	-	-
1.17	ENST00000264122	17	ENSE00000774842	chr3:105397415-105397275	141	CBLB_HUMAN	810-857	48	0	-	-
1.18b	ENST00000264122	18b	ENSE00000774841	chr3:105389196-105389077	120	CBLB_HUMAN	857-897	41	0	-	-
1.19d	ENST00000264122	19d	ENSE00001755904	chr3:105378073-105374305	3769	CBLB_HUMAN	897-982	86	1	C:905-912	8

2.1	ENST00000359314	1	ENSE00001516297	chr6:47445525-47445984	460	CD2AP_HUMAN	1-2	2	1	A:2-2	1
2.2	ENST00000359314	2	ENSE00000755720	chr6:47471016-47471176	161	CD2AP_HUMAN	2-55	54	1	A:2-55	54
2.3a	ENST00000359314	3a	ENSE00000619362	chr6:47501338-47501491	154	CD2AP_HUMAN	56-107	52	1	A:56-59	4
2.4a	ENST00000359314	4a	ENSE00001139103	chr6:47512342-47512442	101	CD2AP_HUMAN	107-140	34	0	-	-
2.5	ENST00000359314	5	ENSE00001139093	chr6:47522382-47522502	121	CD2AP_HUMAN	141-181	41	0	-	-
2.6	ENST00000359314	6	ENSE00001139085	chr6:47541800-47541987	188	CD2AP_HUMAN	181-243	63	0	-	-
2.7b	ENST00000359314	7b	ENSE00001139077	chr6:47544260-47544338	79	CD2AP_HUMAN	244-270	27	0	-	-
2.8	ENST00000359314	8	ENSE00002190760	chr6:47544745-47544839	95	CD2AP_HUMAN	270-301	32	0	-	-
2.9a	ENST00000359314	9a	ENSE00001139061	chr6:47547121-47547225	105	CD2AP_HUMAN	302-336	35	0	-	-
2.10	ENST00000359314	10	ENSE00002145560	chr6:47548600-47548636	37	CD2AP_HUMAN	337-349	13	0	-	-
2.11a	ENST00000359314	11a	ENSE00001139049	chr6:47549739-47549801	63	CD2AP_HUMAN	349-370	22	0	-	-
2.12	ENST00000359314	12	ENSE00001139043	chr6:47563597-47563762	166	CD2AP_HUMAN	370-425	56	0	-	-
2.13	ENST00000359314	13	ENSE00001139036	chr6:47567037-47567179	143	CD2AP_HUMAN	425-473	49	0	-	-
2.14	ENST00000359314	14	ENSE00001139029	chr6:47573901-47574013	113	CD2AP_HUMAN	473-510	38	0	-	-
2.15b	ENST00000359314	15b	ENSE00001139023	chr6:47575663-47575764	102	CD2AP_HUMAN	511-544	34	0	-	-
2.16a	ENST00000359314	16a	ENSE00001139019	chr6:47576859-47577040	182	CD2AP_HUMAN	545-605	61	0	-	-
2.17	ENST00000359314	17	ENSE00001176400	chr6:47580209-47580272	64	CD2AP_HUMAN	605-626	22	0	-	-
2.18	ENST00000359314	18	ENSE00001454693	chr6:47591922-47594999	3078	CD2AP_HUMAN	627-639	13	0	-	-

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:58
 aligned with CD2AP_HUMAN | Q9Y5K6 from UniProtKB/Swiss-Prot  Length:639

    Alignment length:58
                                    11        21        31        41        51        
          CD2AP_HUMAN     2 VDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKR  59
               SCOP domains ---------------------------------------------------------- SCOP domains
               CATH domains 2j6fA00 A:2-59 SH3 Domains                                 CATH domains
               Pfam domains ---------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee..................eeeeeee.....eeeeee..eeeeee...eee... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------- PROSITE
           Transcript 2 (1) 2-----------------------------------------------------2.3a Transcript 2 (1)
           Transcript 2 (2) Exon 2.2  PDB: A:2-55 UniProt: 2-55                   ---- Transcript 2 (2)
                 2j6f A   2 VDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKR  59
                                    11        21        31        41        51

Chain C from PDB  Type:PROTEIN  Length:8
 aligned with CBLB_HUMAN | Q13191 from UniProtKB/Swiss-Prot  Length:982

    Alignment length:8
           CBLB_HUMAN   905 PPKPRPRR 912
               SCOP domains -------- SCOP domains
               CATH domains -------- CATH domains
               Pfam domains -------- Pfam domains
         Sec.struct. author ........ Sec.struct. author
                 SAPs(SNPs) -------- SAPs(SNPs)
                    PROSITE -------- PROSITE
               Transcript 1 1.19d    Transcript 1
                 2j6f C 905 PPKPRPRR 912

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 2J6F)

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Roll (1513)

Topology: SH3 type barrels. (648)

Homologous Superfamily: SH3 Domains (267)

Human (Homo sapiens) (133)

2j6fA00

A:2-59

(no "Pfam Domain" information available for 2J6F)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (CD2AP_HUMAN | Q9Y5K6)

molecular function
	GO:0017124	SH3 domain binding	Interacting selectively and non-covalently with a SH3 domain (Src homology 3) of a protein, small protein modules containing approximately 50 amino acid residues found in a great variety of intracellular or membrane-associated proteins.
	GO:0008013	beta-catenin binding	Interacting selectively and non-covalently with the beta subunit of the catenin complex.
	GO:0045296	cadherin binding	Interacting selectively and non-covalently with cadherin, a type I membrane protein involved in cell adhesion.
	GO:0008022	protein C-terminus binding	Interacting selectively and non-covalently with a protein C-terminus, the end of any peptide chain at which the 1-carboxy function of a constituent amino acid is not attached in peptide linkage to another amino-acid residue.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0032403	protein complex binding	Interacting selectively and non-covalently with any protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0005200	structural constituent of cytoskeleton	The action of a molecule that contributes to the structural integrity of a cytoskeletal structure.
	GO:0005172	vascular endothelial growth factor receptor binding	Interacting selectively and non-covalently with any vascular endothelial growth factor receptor.
biological process
	GO:0007049	cell cycle	The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
	GO:0051301	cell division	The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.
	GO:0016477	cell migration	The controlled self-propelled movement of a cell from one site to a destination guided by molecular cues. Cell migration is a central process in the development and maintenance of multicellular organisms.
	GO:0032911	negative regulation of transforming growth factor beta1 production	Any process that stops, prevents, or reduces the frequency, rate, or extent of production of transforming growth factor-beta1.
	GO:1900182	positive regulation of protein localization to nucleus	Any process that activates or increases the frequency, rate or extent of protein localization to nucleus.
	GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
	GO:0006461	protein complex assembly	The aggregation, arrangement and bonding together of a set of components to form a protein complex.
	GO:2000249	regulation of actin cytoskeleton reorganization	Any process that modulates the frequency, rate or extent of actin cytoskeleton reorganization.
	GO:0048259	regulation of receptor-mediated endocytosis	Any process that modulates the frequency, rate or extent of receptor mediated endocytosis, the uptake of external materials by cells, utilizing receptors to ensure specificity of transport.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
	GO:0016337	single organismal cell-cell adhesion	The attachment of one cell to another cell via adhesion molecules, where both cells are part of the same organism.
	GO:0006930	substrate-dependent cell migration, cell extension	The formation of a cell surface protrusion, such as a lamellipodium or filopodium, at the leading edge of a migrating cell.
	GO:0016050	vesicle organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of a vesicle.
cellular component
	GO:0015629	actin cytoskeleton	The part of the cytoskeleton (the internal framework of a cell) composed of actin and associated proteins. Includes actin cytoskeleton-associated complexes.
	GO:0031252	cell leading edge	The area of a motile cell closest to the direction of movement.
	GO:0042995	cell projection	A prolongation or process extending from a cell, e.g. a flagellum or axon.
	GO:0005911	cell-cell junction	A cell junction that forms a connection between two or more cells in a multicellular organism; excludes direct cytoplasmic junctions such as ring canals.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
	GO:0030139	endocytic vesicle	A membrane-bounded intracellular vesicle formed by invagination of the plasma membrane around an extracellular substance. Endocytic vesicles fuse with early endosomes to deliver the cargo for further sorting.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0031941	filamentous actin	A two-stranded helical polymer of the protein actin.
	GO:0005730	nucleolus	A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
	GO:0048471	perinuclear region of cytoplasm	Cytoplasm situated near, or occurring around, the nucleus.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.
	GO:0001726	ruffle	Projection at the leading edge of a crawling cell; the protrusions are supported by a microfilament meshwork.

Chain C (CBLB_HUMAN | Q13191)

molecular function
	GO:0005509	calcium ion binding	Interacting selectively and non-covalently with calcium ions (Ca2+).
	GO:0016874	ligase activity	Catalysis of the joining of two substances, or two groups within a single molecule, with the concomitant hydrolysis of the diphosphate bond in ATP or a similar triphosphate.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0001784	phosphotyrosine residue binding	Interacting selectively and non-covalently with a phosphorylated tyrosine residue within a protein.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0019901	protein kinase binding	Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
	GO:0004871	signal transducer activity	Conveys a signal across a cell to trigger a change in cell function or state. A signal is a physical entity or change in state that is used to transfer information in order to trigger a response.
	GO:0004842	ubiquitin-protein transferase activity	Catalysis of the transfer of ubiquitin from one protein to another via the reaction X-Ub + Y --> Y-Ub + X, where both X-Ub and Y-Ub are covalent linkages.
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0006607	NLS-bearing protein import into nucleus	The directed movement of a protein bearing a nuclear localization signal (NLS) from the cytoplasm into the nucleus, across the nuclear membrane.
	GO:0007166	cell surface receptor signaling pathway	A series of molecular signals initiated by activation of a receptor on the surface of a cell. The pathway begins with binding of an extracellular ligand to a cell surface receptor, or for receptors that signal in the absence of a ligand, by ligand-withdrawal or the activity of a constitutively active receptor. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
	GO:0000209	protein polyubiquitination	Addition of multiple ubiquitin groups to a protein, forming a ubiquitin chain.
	GO:0016567	protein ubiquitination	The process in which one or more ubiquitin groups are added to a protein.
	GO:0023051	regulation of signaling	Any process that modulates the frequency, rate or extent of a signaling process.
	GO:0009629	response to gravity	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a gravitational stimulus.
	GO:0009725	response to hormone	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a hormone stimulus.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0045121	membrane raft	Any of the small (10-200 nm), heterogeneous, highly dynamic, sterol- and sphingolipid-enriched membrane domains that compartmentalize cellular processes. Small rafts can sometimes be stabilized to form larger platforms through protein-protein and protein-lipid interactions.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2j6f)

	Sites
(no "Sites" information available for 2j6f)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2j6f)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2j6f
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CBLB_HUMAN \| Q13191
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	CD2AP_HUMAN \| Q9Y5K6
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	6.3.2.-
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CBLB_HUMAN \| Q13191
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	CD2AP_HUMAN \| Q9Y5K6
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

2j6k	N-TERMINAL SH3 DOMAIN OF CMS (CD2AP HUMAN HOMOLOG)
2j6o	ATYPICAL POLYPROLINE RECOGNITION BY THE CMS N-TERMINAL SH3 DOMAIN. CMS:CD2 HETEROTRIMER
2j7i	ATYPICAL POLYPROLINE RECOGNITION BY THE CMS N-TERMINAL SH3 DOMAIN.CMS:CD2 HETERODIMER

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (4, 4)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (1, 1)

Pfam Domains (0, 0)

Gene Ontology (54, 58)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File