2J7I - JenaLib

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   ATYPICAL POLYPROLINE RECOGNITION BY THE CMS N-TERMINAL SH3 DOMAIN. CMS:CD2 HETERODIMER

Authors :   G. Moncalian, N. Cardenes, Y. L. Deribe, M. Spinola-Amilibia, I. Dikic

Date :   09 Oct 06 (Deposition) - 06 Nov 06 (Release) - 05 Jul 17 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.90

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,C  (1x)
Biol. Unit 2: B,D  (1x)

Keywords :   Coiled Coil, Polymorphism, Glycoprotein, Cell Adhesion, Egfr Downregulation, Immunoglobulin Domain, Transmembrane, Phosphorylation, Adaptor Protein, Cms, Cd2Ad, Membrane, Sh3 Domain, Sh3-Binding, Sh3 Domain Recognition, Protein Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   G. Moncalian, N. Cardenes, Y. L. Deribe, M. Spinola-Amilibia, I. Dikic, J. Bravo
Atypical Polyproline Recognition By The Cms N-Terminal Src Homology 3 Domain.
J. Biol. Chem. V. 281 38845 2006
PubMed-ID: 17020880 | Reference-DOI: 10.1074/JBC.M606411200

Molecule 1 - CD2-ASSOCIATED PROTEIN
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET 21A
	Expression System Strain	:	ROSSETTA (DE3) PLYS
	Expression System Taxid	:	562
	Fragment	:	SH3 DOMAIN, RESIDUES 1-62
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	N-TERMINAL SH3 DOMAIN FROM CMS (CAS LIGAND WITH MULTIPLE SH3 DOMAINS) OR CD2AP (CD2-ASSOCIATED PROTEIN)
	Synonym	:	CAS LIGAND WITH MULTIPLE SH3 DOMAINS, ADAPTER PROTEIN CMS, CMS

Molecule 2 - T-CELL SURFACE ANTIGEN CD2
	Chains	:	C, D
	Engineered	:	YES
	Fragment	:	CMS BINDING SEQUENCE, RESIDUES 324-333
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	T-CELL SURFACE ANTIGEN T11/LEU-5, LFA-2, LFA-3 RECEPTOR, ERYTHROCYTE RECEPTOR, ROSETTE RECEPTOR, CD2
	Synthetic	:	YES

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A		C
Biological Unit 2 (1x)	:		B		D

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2J7I)

(no "Site" information available for 2J7I)

(no "SS Bond" information available for 2J7I)

(no "Cis Peptide Bond" information available for 2J7I)

(no "SAP(SNP)/Variant" information available for 2J7I)

Asymmetric Unit (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SH3	PS50002	Src homology 3 (SH3) domain profile.	CD2AP_HUMAN	1-59 108-167 269-330	1	A:1-59 - -

Biological Unit 1 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SH3	PS50002	Src homology 3 (SH3) domain profile.	CD2AP_HUMAN	1-59 108-167 269-330	1	A:1-59 - -

Biological Unit 2 (, 0)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SH3	PS50002	Src homology 3 (SH3) domain profile.	CD2AP_HUMAN	1-59 108-167 269-330	0	- - -

Asymmetric Unit (4, 8)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000359314	1	ENSE00001516297	chr6:47445525-47445984	460	CD2AP_HUMAN	1-2	2	2	A:1-2 B:2-2	2 1
1.2	ENST00000359314	2	ENSE00000755720	chr6:47471016-47471176	161	CD2AP_HUMAN	2-55	54	2	A:2-55 B:2-55	54 54
1.3a	ENST00000359314	3a	ENSE00000619362	chr6:47501338-47501491	154	CD2AP_HUMAN	56-107	52	2	A:56-59 B:56-59	4 4
1.4a	ENST00000359314	4a	ENSE00001139103	chr6:47512342-47512442	101	CD2AP_HUMAN	107-140	34	0	-	-
1.5	ENST00000359314	5	ENSE00001139093	chr6:47522382-47522502	121	CD2AP_HUMAN	141-181	41	0	-	-
1.6	ENST00000359314	6	ENSE00001139085	chr6:47541800-47541987	188	CD2AP_HUMAN	181-243	63	0	-	-
1.7b	ENST00000359314	7b	ENSE00001139077	chr6:47544260-47544338	79	CD2AP_HUMAN	244-270	27	0	-	-
1.8	ENST00000359314	8	ENSE00002190760	chr6:47544745-47544839	95	CD2AP_HUMAN	270-301	32	0	-	-
1.9a	ENST00000359314	9a	ENSE00001139061	chr6:47547121-47547225	105	CD2AP_HUMAN	302-336	35	0	-	-
1.10	ENST00000359314	10	ENSE00002145560	chr6:47548600-47548636	37	CD2AP_HUMAN	337-349	13	0	-	-
1.11a	ENST00000359314	11a	ENSE00001139049	chr6:47549739-47549801	63	CD2AP_HUMAN	349-370	22	0	-	-
1.12	ENST00000359314	12	ENSE00001139043	chr6:47563597-47563762	166	CD2AP_HUMAN	370-425	56	0	-	-
1.13	ENST00000359314	13	ENSE00001139036	chr6:47567037-47567179	143	CD2AP_HUMAN	425-473	49	0	-	-
1.14	ENST00000359314	14	ENSE00001139029	chr6:47573901-47574013	113	CD2AP_HUMAN	473-510	38	0	-	-
1.15b	ENST00000359314	15b	ENSE00001139023	chr6:47575663-47575764	102	CD2AP_HUMAN	511-544	34	0	-	-
1.16a	ENST00000359314	16a	ENSE00001139019	chr6:47576859-47577040	182	CD2AP_HUMAN	545-605	61	0	-	-
1.17	ENST00000359314	17	ENSE00001176400	chr6:47580209-47580272	64	CD2AP_HUMAN	605-626	22	0	-	-
1.18	ENST00000359314	18	ENSE00001454693	chr6:47591922-47594999	3078	CD2AP_HUMAN	627-639	13	0	-	-

2.1a	ENST00000369478	1a	ENSE00001450130	chr1:117297007-117297175	169	CD2_HUMAN	1-21	21	0	-	-
2.2a	ENST00000369478	2a	ENSE00000785006	chr1:117297253-117297573	321	CD2_HUMAN	21-128	108	0	-	-
2.3	ENST00000369478	3	ENSE00000785007	chr1:117303024-117303254	231	CD2_HUMAN	128-205	78	0	-	-
2.4	ENST00000369478	4	ENSE00000785008	chr1:117307106-117307228	123	CD2_HUMAN	205-246	42	0	-	-
2.5	ENST00000369478	5	ENSE00001141790	chr1:117311086-117311850	765	CD2_HUMAN	246-351	106	2	C:325-333 D:324-333	9 10

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:59
 aligned with CD2AP_HUMAN | Q9Y5K6 from UniProtKB/Swiss-Prot  Length:639

    Alignment length:59
                                    10        20        30        40        50         
          CD2AP_HUMAN     1 MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKR  59
               SCOP domains ----------------------------------------------------------- SCOP domains
               CATH domains 2j7iA00 A:1-59 SH3 Domains                                  CATH domains
               Pfam domains ----------------------------------------------------------- Pfam domains
         Sec.struct. author ...eee..................eeeeeee.....eeeee....eeeee...eee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------- SAPs(SNPs)
                    PROSITE SH3  PDB: A:1-59 UniProt: 1-59                              PROSITE
           Transcript 1 (1) 1.-----------------------------------------------------1.3a Transcript 1 (1)
           Transcript 1 (2) -Exon 1.2  PDB: A:2-55 UniProt: 2-55                   ---- Transcript 1 (2)
                 2j7i A   1 MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKR  59
                                    10        20        30        40        50

Chain B from PDB  Type:PROTEIN  Length:58
 aligned with CD2AP_HUMAN | Q9Y5K6 from UniProtKB/Swiss-Prot  Length:639

    Alignment length:58
                                    11        21        31        41        51        
          CD2AP_HUMAN     2 VDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKR  59
               SCOP domains ---------------------------------------------------------- SCOP domains
               CATH domains 2j7iB00 B:2-59 SH3 Domains                                 CATH domains
               Pfam domains ---------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee..................eeeeee......eeeeee..eeeeee...eee... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------- SAPs(SNPs)
                    PROSITE SH3  PDB: - UniProt: 1-59                                  PROSITE
           Transcript 1 (1) 1-----------------------------------------------------1.3a Transcript 1 (1)
           Transcript 1 (2) Exon 1.2  PDB: B:2-55 UniProt: 2-55                   ---- Transcript 1 (2)
                 2j7i B   2 VDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKR  59
                                    11        21        31        41        51

Chain C from PDB  Type:PROTEIN  Length:9
 aligned with CD2_HUMAN | P06729 from UniProtKB/Swiss-Prot  Length:351

    Alignment length:9
            CD2_HUMAN   325 GPPLPRPRV 333
               SCOP domains --------- SCOP domains
               CATH domains --------- CATH domains
               Pfam domains --------- Pfam domains
         Sec.struct. author ......... Sec.struct. author
                 SAPs(SNPs) --------- SAPs(SNPs)
                    PROSITE --------- PROSITE
               Transcript 2 Exon 2.5  Transcript 2
                 2j7i C 325 GPPLPRPRV 333

Chain D from PDB  Type:PROTEIN  Length:10
 aligned with CD2_HUMAN | P06729 from UniProtKB/Swiss-Prot  Length:351

    Alignment length:10
                                   333
            CD2_HUMAN   324 KGPPLPRPRV 333
               SCOP domains ---------- SCOP domains
               CATH domains ---------- CATH domains
               Pfam domains ---------- Pfam domains
         Sec.struct. author .......... Sec.struct. author
                 SAPs(SNPs) ---------- SAPs(SNPs)
                    PROSITE ---------- PROSITE
               Transcript 2 Exon 2.5   Transcript 2
                 2j7i D 324 KGPPLPRPRV 333
                                   333

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 2J7I)

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Roll (1513)

Topology: SH3 type barrels. (648)

Homologous Superfamily: SH3 Domains (267)

Human (Homo sapiens) (133)

1a	2j7iA00	A:1-59
1b	2j7iB00	B:2-59

(no "Pfam Domain" information available for 2J7I)

Asymmetric Unit(hide GO term definitions)

Chain A,B (CD2AP_HUMAN | Q9Y5K6)

molecular function
	GO:0017124	SH3 domain binding	Interacting selectively and non-covalently with a SH3 domain (Src homology 3) of a protein, small protein modules containing approximately 50 amino acid residues found in a great variety of intracellular or membrane-associated proteins.
	GO:0008013	beta-catenin binding	Interacting selectively and non-covalently with the beta subunit of the catenin complex.
	GO:0045296	cadherin binding	Interacting selectively and non-covalently with cadherin, a type I membrane protein involved in cell adhesion.
	GO:0008022	protein C-terminus binding	Interacting selectively and non-covalently with a protein C-terminus, the end of any peptide chain at which the 1-carboxy function of a constituent amino acid is not attached in peptide linkage to another amino-acid residue.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0032403	protein complex binding	Interacting selectively and non-covalently with any protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0005200	structural constituent of cytoskeleton	The action of a molecule that contributes to the structural integrity of a cytoskeletal structure.
	GO:0005172	vascular endothelial growth factor receptor binding	Interacting selectively and non-covalently with any vascular endothelial growth factor receptor.
biological process
	GO:0007049	cell cycle	The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
	GO:0051301	cell division	The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.
	GO:0016477	cell migration	The controlled self-propelled movement of a cell from one site to a destination guided by molecular cues. Cell migration is a central process in the development and maintenance of multicellular organisms.
	GO:0032911	negative regulation of transforming growth factor beta1 production	Any process that stops, prevents, or reduces the frequency, rate, or extent of production of transforming growth factor-beta1.
	GO:1900182	positive regulation of protein localization to nucleus	Any process that activates or increases the frequency, rate or extent of protein localization to nucleus.
	GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
	GO:0006461	protein complex assembly	The aggregation, arrangement and bonding together of a set of components to form a protein complex.
	GO:2000249	regulation of actin cytoskeleton reorganization	Any process that modulates the frequency, rate or extent of actin cytoskeleton reorganization.
	GO:0048259	regulation of receptor-mediated endocytosis	Any process that modulates the frequency, rate or extent of receptor mediated endocytosis, the uptake of external materials by cells, utilizing receptors to ensure specificity of transport.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
	GO:0016337	single organismal cell-cell adhesion	The attachment of one cell to another cell via adhesion molecules, where both cells are part of the same organism.
	GO:0006930	substrate-dependent cell migration, cell extension	The formation of a cell surface protrusion, such as a lamellipodium or filopodium, at the leading edge of a migrating cell.
	GO:0016050	vesicle organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of a vesicle.
cellular component
	GO:0015629	actin cytoskeleton	The part of the cytoskeleton (the internal framework of a cell) composed of actin and associated proteins. Includes actin cytoskeleton-associated complexes.
	GO:0031252	cell leading edge	The area of a motile cell closest to the direction of movement.
	GO:0042995	cell projection	A prolongation or process extending from a cell, e.g. a flagellum or axon.
	GO:0005911	cell-cell junction	A cell junction that forms a connection between two or more cells in a multicellular organism; excludes direct cytoplasmic junctions such as ring canals.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
	GO:0030139	endocytic vesicle	A membrane-bounded intracellular vesicle formed by invagination of the plasma membrane around an extracellular substance. Endocytic vesicles fuse with early endosomes to deliver the cargo for further sorting.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0031941	filamentous actin	A two-stranded helical polymer of the protein actin.
	GO:0005730	nucleolus	A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
	GO:0048471	perinuclear region of cytoplasm	Cytoplasm situated near, or occurring around, the nucleus.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.
	GO:0001726	ruffle	Projection at the leading edge of a crawling cell; the protrusions are supported by a microfilament meshwork.

Chain C,D (CD2_HUMAN | P06729)

molecular function
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0004872	receptor activity	Combining with an extracellular or intracellular messenger to initiate a change in cell activity.
	GO:0005102	receptor binding	Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
biological process
	GO:0042110	T cell activation	The change in morphology and behavior of a mature or immature T cell resulting from exposure to a mitogen, cytokine, chemokine, cellular ligand, or an antigen for which it is specific.
	GO:0006915	apoptotic process	A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
	GO:0007155	cell adhesion	The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
	GO:0007166	cell surface receptor signaling pathway	A series of molecular signals initiated by activation of a receptor on the surface of a cell. The pathway begins with binding of an extracellular ligand to a cell surface receptor, or for receptors that signal in the absence of a ligand, by ligand-withdrawal or the activity of a constitutively active receptor. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
	GO:0034113	heterotypic cell-cell adhesion	The attachment of a cell to a cell of a different type via adhesion molecules.
	GO:0050900	leukocyte migration	The movement of a leukocyte within or between different tissues and organs of the body.
	GO:0001766	membrane raft polarization	The clustering and aggregation of membrane rafts at a single cellular pole during activation of particular cell types, such as lymphocytes.
	GO:0030101	natural killer cell activation	The change in morphology and behavior of a natural killer cell in response to a cytokine, chemokine, cellular ligand, or soluble factor.
	GO:1902715	positive regulation of interferon-gamma secretion	Any process that activates or increases the frequency, rate or extent of interferon-gamma secretion.
	GO:2000484	positive regulation of interleukin-8 secretion	Any process that activates or increases the frequency, rate or extent of interleukin-8 secretion.
	GO:0030887	positive regulation of myeloid dendritic cell activation	Any process that stimulates, induces or increases the rate of myeloid dendritic cell activation.
	GO:0032760	positive regulation of tumor necrosis factor production	Any process that activates or increases the frequency, rate, or extent of tumor necrosis factor production.
	GO:0045580	regulation of T cell differentiation	Any process that modulates the frequency, rate or extent of T cell differentiation.
	GO:0016337	single organismal cell-cell adhesion	The attachment of one cell to another cell via adhesion molecules, where both cells are part of the same organism.
cellular component
	GO:0046658	anchored component of plasma membrane	The component of the plasma membrane consisting of the gene products that are tethered to the membrane only by a covalently attached anchor, such as a lipid group, that is embedded in the membrane. Gene products with peptide sequences that are embedded in the membrane are excluded from this grouping.
	GO:0009986	cell surface	The external part of the cell wall and/or plasma membrane.
	GO:0005911	cell-cell junction	A cell junction that forms a connection between two or more cells in a multicellular organism; excludes direct cytoplasmic junctions such as ring canals.
	GO:0009898	cytoplasmic side of plasma membrane	The leaflet the plasma membrane that faces the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
	GO:0009897	external side of plasma membrane	The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2j7i)

	Sites
(no "Sites" information available for 2j7i)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2j7i)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2j7i
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CD2AP_HUMAN \| Q9Y5K6
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	CD2_HUMAN \| P06729
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CD2AP_HUMAN \| Q9Y5K6
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	CD2_HUMAN \| P06729
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

1cdb
1gya	N-GLYCAN AND POLYPEPTIDE NMR SOLUTION STRUCTURES OF THE ADHESION DOMAIN OF HUMAN CD2
1hnf	CD2 (HUMAN)
1l2z	CD2BP2-GYF DOMAIN IN COMPLEX WITH PROLINE- RICH CD2 TAILSEGMENT PEPTIDE
2bz8	N-TERMINAL SH3 DOMAIN OF CIN85 BOUND TO CBL-B PEPTIDE
2j6f	N-TERMINAL SH3 DOMAIN OF CMS (CD2AP HUMAN HOMOLOG) BOUND TO CBL-B PEPTIDE
2j6k	N-TERMINAL SH3 DOMAIN OF CMS (CD2AP HUMAN HOMOLOG)
2j6o	ATYPICAL POLYPROLINE RECOGNITION BY THE CMS N-TERMINAL SH3 DOMAIN. CMS:CD2 HETEROTRIMER

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 1)

Exons (4, 8)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (59, 63)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File