2IZY - JenaLib

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:47
 aligned with KAP2_MOUSE | P12367 from UniProtKB/Swiss-Prot  Length:401

    Alignment length:55
                                              23                                   
                                            22 |                                   
                                    14       |23        33        43        53     
            KAP2_MOUSE    5 QIPPGLTELLQGYTVEVG-QQPPDLVDFAVEYFTRLREARRQESDTFIVSPTTFH 58
               SCOP domains d2izya_ A: automated matches                            SCOP domains
               CATH domains ------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh--------hhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------- Transcript
                  2izy A  6 QIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARR--------GLEHHH 52
                                    15        25        35        45|       47     
                                                                   46       47

Chain A from PDB  Type:PROTEIN  Length:47
 aligned with KAP2_RAT | P12368 from UniProtKB/Swiss-Prot  Length:401

    Alignment length:69
                                    14        24        34        44        54        64         
              KAP2_RAT    5 QIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARRQESDSFIAPPTTFHAQESSGVPVIEEDG 73
               SCOP domains d2izya_ A: automated matches                                          SCOP domains
               CATH domains --------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh----------------------hhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------- Transcript
                  2izy A  6 QIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARRG----------------------LEHHH 52
                                    15        25        35        45 |       -         -    |    
                                                                    47                     48

Chain B from PDB  Type:PROTEIN  Length:46
 aligned with KAP2_MOUSE | P12367 from UniProtKB/Swiss-Prot  Length:401

    Alignment length:83
                                               23                                                              
                                             22 |                                                              
                                    13        |-|       32        42        52        62        72        82   
            KAP2_MOUSE    4 IQIPPGLTELLQGYTVEVG-QQPPDLVDFAVEYFTRLREARRQESDTFIVSPTTFHTQESSAVPVIEEDGESDSDSEDADLEV 85
               SCOP domains d2izyb_ B: automated matches                                                        SCOP domains
               CATH domains ----------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh---------------------------h----------hhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------- Transcript
                  2izy B  5 IQIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARR---------------------------G----------LEH 50
                                    14        24        34        44 |       -         -        47         -|  
                                                                    46                          47         48

Chain B from PDB  Type:PROTEIN  Length:46
 aligned with KAP2_RAT | P12368 from UniProtKB/Swiss-Prot  Length:401

    Alignment length:83
                                    13        23        33        43        53        63        73        83   
              KAP2_RAT    4 IQIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARRQESDSFIAPPTTFHAQESSGVPVIEEDGESESDSDDEDLEV 86
               SCOP domains d2izyb_ B: automated matches                                                        SCOP domains
               CATH domains ----------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh-------------------h------------------hhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------- Transcript
                  2izy B  5 IQIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARR-------------------G------------------LEH 50
                                    14        24        34        44 |       -         - |       -         -|  
                                                                    46                  47                 48

Chain C from PDB  Type:PROTEIN  Length:46
 aligned with KAP2_MOUSE | P12367 from UniProtKB/Swiss-Prot  Length:401

    Alignment length:68
                                              23                                                
                                            22 |                                                
                                    14       |23        33        43        53        63        
            KAP2_MOUSE    5 QIPPGLTELLQGYTVEVG-QQPPDLVDFAVEYFTRLREARRQESDTFIVSPTTFHTQESSAVPVIEED 71
               SCOP domains d2izyc_ C: automated matches                                         SCOP domains
               CATH domains -------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh----------------------hhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------- Transcript
                  2izy C  6 QIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARRG----------------------LEHH 51
                                    15        25        35        45 |       -         -    |   
                                                                    47                     48

Chain C from PDB  Type:PROTEIN  Length:46
 aligned with KAP2_RAT | P12368 from UniProtKB/Swiss-Prot  Length:401

    Alignment length:68
                                    14        24        34        44        54        64        
              KAP2_RAT    5 QIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARRQESDSFIAPPTTFHAQESSGVPVIEED 72
               SCOP domains d2izyc_ C: automated matches                                         SCOP domains
               CATH domains -------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh----------------------hhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------- Transcript
                  2izy C  6 QIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARRG----------------------LEHH 51
                                    15        25        35        45 |       -         -    |   
                                                                    47                     48

Chain D from PDB  Type:PROTEIN  Length:48
 aligned with KAP2_MOUSE | P12367 from UniProtKB/Swiss-Prot  Length:401

    Alignment length:56
                                               23                                   
                                             22 |                                   
                                    13        |-|       32        42        52      
            KAP2_MOUSE    4 IQIPPGLTELLQGYTVEVG-QQPPDLVDFAVEYFTRLREARRQESDTFIVSPTTFH 58
               SCOP domains d2izyd_ D: automated matches                             SCOP domains
               CATH domains 2izyD00 D:5-52                                           CATH domains
               Pfam domains -------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh--------hhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------- Transcript
                  2izy D  5 IQIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARR--------GLEHHH 52
                                    14        24        34        44 |       -|     
                                                                    46       47

Chain D from PDB  Type:PROTEIN  Length:48
 aligned with KAP2_RAT | P12368 from UniProtKB/Swiss-Prot  Length:401

    Alignment length:70
                                    13        23        33        43        53        63        73
              KAP2_RAT    4 IQIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARRQESDSFIAPPTTFHAQESSGVPVIEEDG 73
               SCOP domains d2izyd_ D: automated matches                                           SCOP domains
               CATH domains 2izyD00 D:5-52                                                         CATH domains
               Pfam domains ---------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh----------------------hhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------- Transcript
                  2izy D  5 IQIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARRG----------------------LEHHH 52
                                    14        24        34        44  |      -         -     |  52
                                                                     47                     48

Chain E from PDB  Type:PROTEIN  Length:48
 aligned with KAP2_MOUSE | P12367 from UniProtKB/Swiss-Prot  Length:401

    Alignment length:56
                                               23                                   
                                             22 |                                   
                                    13        |-|       32        42        52      
            KAP2_MOUSE    4 IQIPPGLTELLQGYTVEVG-QQPPDLVDFAVEYFTRLREARRQESDTFIVSPTTFH 58
               SCOP domains d2izye_ E: automated matches                             SCOP domains
               CATH domains -------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh--------hhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------- Transcript
                  2izy E  5 IQIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARR--------GLEHHH 52
                                    14        24        34        44 |       -|     
                                                                    46       47

Chain E from PDB  Type:PROTEIN  Length:48
 aligned with KAP2_RAT | P12368 from UniProtKB/Swiss-Prot  Length:401

    Alignment length:70
                                    13        23        33        43        53        63        73
              KAP2_RAT    4 IQIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARRQESDSFIAPPTTFHAQESSGVPVIEEDG 73
               SCOP domains d2izye_ E: automated matches                                           SCOP domains
               CATH domains ---------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh----------------------hhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------- Transcript
                  2izy E  5 IQIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARRG----------------------LEHHH 52
                                    14        24        34        44  |      -         -     |  52
                                                                     47                     48

Chain F from PDB  Type:PROTEIN  Length:48
 aligned with KAP2_MOUSE | P12367 from UniProtKB/Swiss-Prot  Length:401

    Alignment length:56
                                               23                                   
                                             22 |                                   
                                    13        |-|       32        42        52      
            KAP2_MOUSE    4 IQIPPGLTELLQGYTVEVG-QQPPDLVDFAVEYFTRLREARRQESDTFIVSPTTFH 58
               SCOP domains d2izyf_ F: automated matches                             SCOP domains
               CATH domains -------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh--------hhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------- Transcript
                  2izy F  5 IQIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARR--------GLEHHH 52
                                    14        24        34        44 |       -|     
                                                                    46       47

Chain F from PDB  Type:PROTEIN  Length:48
 aligned with KAP2_RAT | P12368 from UniProtKB/Swiss-Prot  Length:401

    Alignment length:70
                                    13        23        33        43        53        63        73
              KAP2_RAT    4 IQIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARRQESDSFIAPPTTFHAQESSGVPVIEEDG 73
               SCOP domains d2izyf_ F: automated matches                                           SCOP domains
               CATH domains ---------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh----------------------hhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------- Transcript
                  2izy F  5 IQIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARRG----------------------LEHHH 52
                                    14        24        34        44  |      -         -     |  52
                                                                     47                     48

Chain G from PDB  Type:PROTEIN  Length:45
 aligned with KAP2_MOUSE | P12367 from UniProtKB/Swiss-Prot  Length:401

    Alignment length:82
                                              23                                                              
                                            22 |                                                              
                                    14       |23        33        43        53        63        73        83  
            KAP2_MOUSE    5 QIPPGLTELLQGYTVEVG-QQPPDLVDFAVEYFTRLREARRQESDTFIVSPTTFHTQESSAVPVIEEDGESDSDSEDADLEV 85
               SCOP domains d2izyg_ G: automated matches                                                       SCOP domains
               CATH domains ---------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh---------------------------h----------hhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------- Transcript
                  2izy G  6 QIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARR---------------------------G----------LEH 50
                                    15        25        35        45|        -         -        |-        48  
                                                                   46                          47         48

Chain G from PDB  Type:PROTEIN  Length:45
 aligned with KAP2_RAT | P12368 from UniProtKB/Swiss-Prot  Length:401

    Alignment length:82
                                    14        24        34        44        54        64        74        84  
              KAP2_RAT    5 QIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARRQESDSFIAPPTTFHAQESSGVPVIEEDGESESDSDDEDLEV 86
               SCOP domains d2izyg_ G: automated matches                                                       SCOP domains
               CATH domains ---------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh-------------------h------------------hhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------- Transcript
                  2izy G  6 QIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARR-------------------G------------------LEH 50
                                    15        25        35        45|        -         -|        -        48  
                                                                   46                  47                 48

Chain H from PDB  Type:PROTEIN  Length:47
 aligned with KAP2_MOUSE | P12367 from UniProtKB/Swiss-Prot  Length:401

    Alignment length:69
                                               23                                                
                                             22 |                                                
                                    13        |-|       32        42        52        62         
            KAP2_MOUSE    4 IQIPPGLTELLQGYTVEVG-QQPPDLVDFAVEYFTRLREARRQESDTFIVSPTTFHTQESSAVPVIEED 71
               SCOP domains d2izyh_ H: automated matches                                          SCOP domains
               CATH domains --------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh----------------------hhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------- Transcript
                  2izy H  5 IQIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARRG----------------------LEHH 51
                                    14        24        34        44  |      -         -     |   
                                                                     47                     48

Chain H from PDB  Type:PROTEIN  Length:47
 aligned with KAP2_RAT | P12368 from UniProtKB/Swiss-Prot  Length:401

    Alignment length:69
                                    13        23        33        43        53        63         
              KAP2_RAT    4 IQIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARRQESDSFIAPPTTFHAQESSGVPVIEED 72
               SCOP domains d2izyh_ H: automated matches                                          SCOP domains
               CATH domains --------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh----------------------hhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------- Transcript
                  2izy H  5 IQIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARRG----------------------LEHH 51
                                    14        24        34        44  |      -         -     |   
                                                                     47                     48

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B,C,D,E,F,G,H (KAP2_MOUSE | P12367)

molecular function
	GO:0030552	cAMP binding	Interacting selectively and non-covalently with cAMP, the nucleotide cyclic AMP (adenosine 3',5'-cyclophosphate).
	GO:0004862	cAMP-dependent protein kinase inhibitor activity	Stops, prevents or reduces the activity of a cAMP-dependent protein kinase.
	GO:0008603	cAMP-dependent protein kinase regulator activity	Modulation of the activity of the enzyme cAMP-dependent protein kinase.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0034236	protein kinase A catalytic subunit binding	Interacting selectively and non-covalently with one or both of the catalytic subunits of protein kinase A.
	GO:0031625	ubiquitin protein ligase binding	Interacting selectively and non-covalently with a ubiquitin protein ligase enzyme, any of the E3 proteins.
biological process
	GO:2000480	negative regulation of cAMP-dependent protein kinase activity	Any process that stops, prevents or reduces the frequency, rate or extent of cAMP-dependent protein kinase activity.
	GO:0001932	regulation of protein phosphorylation	Any process that modulates the frequency, rate or extent of addition of phosphate groups into an amino acid in a protein.
cellular component
	GO:0005952	cAMP-dependent protein kinase complex	An enzyme complex, composed of regulatory and catalytic subunits, that catalyzes protein phosphorylation. Inactive forms of the enzyme have two regulatory chains and two catalytic chains; activation by cAMP produces two active catalytic monomers and a regulatory dimer.
	GO:0005813	centrosome	A structure comprised of a core structure (in most organisms, a pair of centrioles) and peripheral material from which a microtubule-based structure, such as a spindle apparatus, is organized. Centrosomes occur close to the nucleus during interphase in many eukaryotic cells, though in animal cells it changes continually during the cell-division cycle.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005925	focal adhesion	Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0031588	nucleotide-activated protein kinase complex	A protein complex that possesses nucleotide-dependent protein kinase activity. The nucleotide can be AMP (in S. pombe and human) or ADP (in S. cerevisiae).
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0044853	plasma membrane raft	A membrane raft that is part of the plasma membrane.

Chain A,B,C,D,E,F,G,H (KAP2_RAT | P12368)

molecular function
	GO:0030552	cAMP binding	Interacting selectively and non-covalently with cAMP, the nucleotide cyclic AMP (adenosine 3',5'-cyclophosphate).
	GO:0008603	cAMP-dependent protein kinase regulator activity	Modulation of the activity of the enzyme cAMP-dependent protein kinase.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0019904	protein domain specific binding	Interacting selectively and non-covalently with a specific domain of a protein.
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0034236	protein kinase A catalytic subunit binding	Interacting selectively and non-covalently with one or both of the catalytic subunits of protein kinase A.
	GO:0036094	small molecule binding	Interacting selectively and non-covalently with a small molecule, any low molecular weight, monomeric, non-encoded molecule.
biological process
	GO:0051291	protein heterooligomerization	The process of creating protein oligomers, compounds composed of a small number, usually between three and ten, of component monomers that are not all identical. Oligomers may be formed by the polymerization of a number of monomers or the depolymerization of a large protein polymer.
	GO:0045859	regulation of protein kinase activity	Any process that modulates the frequency, rate or extent of protein kinase activity.
	GO:0001932	regulation of protein phosphorylation	Any process that modulates the frequency, rate or extent of addition of phosphate groups into an amino acid in a protein.
	GO:0097338	response to clozapine	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a clozapine stimulus.
cellular component
	GO:0030315	T-tubule	Invagination of the plasma membrane of a muscle cell that extends inward from the cell surface around each myofibril. The ends of T-tubules make contact with the sarcoplasmic reticulum membrane.
	GO:0005952	cAMP-dependent protein kinase complex	An enzyme complex, composed of regulatory and catalytic subunits, that catalyzes protein phosphorylation. Inactive forms of the enzyme have two regulatory chains and two catalytic chains; activation by cAMP produces two active catalytic monomers and a regulatory dimer.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0048471	perinuclear region of cytoplasm	Cytoplasm situated near, or occurring around, the nucleus.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 8)

CATH Domains (1, 1)

Pfam Domains (0, 0)

Gene Ontology (27, 37)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File