Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  THE MOLECULAR BASIS FOR PROTEIN KINASE A ANCHORING REVEALED BY SOLUTION NMR
 
Authors :  M. G. Newlon, M. Roy, D. Morikis, Z. E. Hausken, V. Coghlan, J. D. Scott, P. A. Jennings
Date :  07 Dec 98  (Deposition) - 16 Dec 98  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A,B  (17x)
Keywords :  Regulatory Subunit, Anchoring, Four-Helix Bundle, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. G. Newlon, M. Roy, D. Morikis, Z. E. Hausken, V. Coghlan, J. D. Scott, P. A. Jennings
The Molecular Basis For Protein Kinase A Anchoring Revealed By Solution Nmr.
Nat. Struct. Biol. V. 6 222 1999
PubMed-ID: 10074940  |  Reference-DOI: 10.1038/6663
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PROTEIN (CAMP-DEPENDENT PROTEIN KINASE TYPE II REGULATORY SUBUNIT)
    ChainsA, B
    EC Number2.7.1.37
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET-16B
    Expression System Taxid562
    FragmentDIMERIZATION-ANCHORING DOMAIN
    GeneRIIA(1-44)
    Organism CommonHOUSE MOUSE
    Organism ScientificMUS MUSCULUS
    Organism Taxid10090
    SynonymRIIA(1-44)

 Structural Features

(-) Chains, Units

  
NMR Structure (17x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1R2A)

(-) Sites  (0, 0)

(no "Site" information available for 1R2A)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1R2A)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1R2A)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1R2A)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1R2A)

(-) Exons   (0, 0)

(no "Exon" information available for 1R2A)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:46
 aligned with KAP2_MOUSE | P12367 from UniProtKB/Swiss-Prot  Length:401

    Alignment length:46
                                                   23                     
                             1                   22 |                     
                             |       9        19  | |   28        38      
            KAP2_MOUSE    - -MSHIQIPPGLTELLQGYTVEVG-QQPPDLVDFAVEYFTRLREARR 44
               SCOP domains d1r2aa_ A:                                     SCOP domains
               CATH domains 1r2aA00 A:1-46                                 CATH domains
               Pfam domains ---------------------------------------------- Pfam domains
         Sec.struct. author ..........hhhhhhhhhhhhhh.....hhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------- PROSITE
                 Transcript ---------------------------------------------- Transcript
                  1r2a A  1 HMGHIQIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARR 46
                                    10        20        30        40      

Chain B from PDB  Type:PROTEIN  Length:46
 aligned with KAP2_MOUSE | P12367 from UniProtKB/Swiss-Prot  Length:401

    Alignment length:46
                                                   23                     
                             1                   22 |                     
                             |       9        19  | |   28        38      
            KAP2_MOUSE    - -MSHIQIPPGLTELLQGYTVEVG-QQPPDLVDFAVEYFTRLREARR 44
               SCOP domains d1r2ab_ B:                                     SCOP domains
               CATH domains 1r2aB00 B:1-46                                 CATH domains
           Pfam domains (1) --------RIIa-1r2aB01 B:9-46                    Pfam domains (1)
           Pfam domains (2) --------RIIa-1r2aB02 B:9-46                    Pfam domains (2)
         Sec.struct. author ..........hhhhhhhhhhhhhh.....hhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------- PROSITE
                 Transcript ---------------------------------------------- Transcript
                  1r2a B  1 HMGHIQIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARR 46
                                    10        20        30        40      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

NMR Structure

(-) CATH Domains  (1, 2)

NMR Structure

(-) Pfam Domains  (1, 2)

NMR Structure
(-)
Clan: RIIa (3)

(-) Gene Ontology  (18, 18)

NMR Structure(hide GO term definitions)
Chain A,B   (KAP2_MOUSE | P12367)
molecular function
    GO:0030552    cAMP binding    Interacting selectively and non-covalently with cAMP, the nucleotide cyclic AMP (adenosine 3',5'-cyclophosphate).
    GO:0004862    cAMP-dependent protein kinase inhibitor activity    Stops, prevents or reduces the activity of a cAMP-dependent protein kinase.
    GO:0008603    cAMP-dependent protein kinase regulator activity    Modulation of the activity of the enzyme cAMP-dependent protein kinase.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0034236    protein kinase A catalytic subunit binding    Interacting selectively and non-covalently with one or both of the catalytic subunits of protein kinase A.
    GO:0031625    ubiquitin protein ligase binding    Interacting selectively and non-covalently with a ubiquitin protein ligase enzyme, any of the E3 proteins.
biological process
    GO:2000480    negative regulation of cAMP-dependent protein kinase activity    Any process that stops, prevents or reduces the frequency, rate or extent of cAMP-dependent protein kinase activity.
    GO:0001932    regulation of protein phosphorylation    Any process that modulates the frequency, rate or extent of addition of phosphate groups into an amino acid in a protein.
cellular component
    GO:0005952    cAMP-dependent protein kinase complex    An enzyme complex, composed of regulatory and catalytic subunits, that catalyzes protein phosphorylation. Inactive forms of the enzyme have two regulatory chains and two catalytic chains; activation by cAMP produces two active catalytic monomers and a regulatory dimer.
    GO:0005813    centrosome    A structure comprised of a core structure (in most organisms, a pair of centrioles) and peripheral material from which a microtubule-based structure, such as a spindle apparatus, is organized. Centrosomes occur close to the nucleus during interphase in many eukaryotic cells, though in animal cells it changes continually during the cell-division cycle.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005925    focal adhesion    Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0031588    nucleotide-activated protein kinase complex    A protein complex that possesses nucleotide-dependent protein kinase activity. The nucleotide can be AMP (in S. pombe and human) or ADP (in S. cerevisiae).
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0044853    plasma membrane raft    A membrane raft that is part of the plasma membrane.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1r2a)
 
  Sites
(no "Sites" information available for 1r2a)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1r2a)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1r2a
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  KAP2_MOUSE | P12367
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.1.37
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  KAP2_MOUSE | P12367
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        KAP2_MOUSE | P123671kmu 1kmw 1l6e 2izy 2qvs 3j4q 3j4r

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1R2A)