|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 5)
|
(no "Site" information available for 2ICT) |
(no "SS Bond" information available for 2ICT) |
(no "Cis Peptide Bond" information available for 2ICT) |
(no "SAP(SNP)/Variant" information available for 2ICT) |
Asymmetric Unit (1, 1)
|
(no "Exon" information available for 2ICT) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:94 aligned with YDDM_ECOL6 | P67700 from UniProtKB/Swiss-Prot Length:94 Alignment length:94 10 20 30 40 50 60 70 80 90 YDDM_ECOL6 1 MKMANHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNAWSLAEAEKTVDVSRLRRLVTQ 94 SCOP domains d2icta_ A: Antitoxin HigA SCOP domains CATH domains -2ictA01 A:2-82 lambda repressor-like DNA-binding domains ------------ CATH domains Pfam domains ---------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (2) ------------HTH_CROC1 PDB: A:13-67 UniProt: 13-67 --------------------------- PROSITE (2) Transcript ---------------------------------------------------------------------------------------------- Transcript 2ict A 1 mKmANHPRPGDIIQESLDELNVSLREFARAmEIAPSTASRLLTGKAALTPEmAIKLSVVIGSSPQmWLNLQNAWSLAEAEKTVDVSRLRRLVTQ 94 | | 10 20 30| 40 50 | 60 | 70 80 90 | | 31-MSE 52-MSE 66-MSE 1-MSE 3-MSE Chain A from PDB Type:PROTEIN Length:94 aligned with YDDM_ECOLI | P67699 from UniProtKB/Swiss-Prot Length:94 Alignment length:94 10 20 30 40 50 60 70 80 90 YDDM_ECOLI 1 MKMANHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNAWSLAEAEKTVDVSRLRRLVTQ 94 SCOP domains d2icta_ A: Antitoxin HigA SCOP domains CATH domains -2ictA01 A:2-82 lambda repressor-like DNA-binding domains ------------ CATH domains Pfam domains ---------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------HTH_CROC1 PDB: A:13-67 UniProt: 13-67 --------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------- Transcript 2ict A 1 mKmANHPRPGDIIQESLDELNVSLREFARAmEIAPSTASRLLTGKAALTPEmAIKLSVVIGSSPQmWLNLQNAWSLAEAEKTVDVSRLRRLVTQ 94 | | 10 20 30| 40 50 | 60 | 70 80 90 1-MSE 31-MSE 52-MSE 66-MSE 3-MSE
|
Asymmetric Unit
|
Asymmetric Unit |
(no "Pfam Domain" information available for 2ICT) |
Asymmetric Unit(hide GO term definitions) Chain A (YDDM_ECOL6 | P67700)
Chain A (YDDM_ECOLI | P67699)
|
|
|
|
|
|
|