|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 4)| Asymmetric Unit (2, 4) Biological Unit 1 (1, 3) Biological Unit 2 (1, 6) |
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2ICP) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2ICP) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2ICP) |
PROSITE Motifs (1, 1)
Asymmetric Unit (1, 1)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2ICP) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:87 aligned with YDDM_ECOL6 | P67700 from UniProtKB/Swiss-Prot Length:94 Alignment length:87 17 27 37 47 57 67 77 87 YDDM_ECOL6 8 RPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNAWSLAEAEKTVDVSRLRRLVTQ 94 SCOP domains d2icpa1 A:8-94 Antitoxin HigA SCOP domains CATH domains 2icpA01 A:8-82 lambda repressor-like DNA-binding domains ------------ CATH domains Pfam domains --------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (2) -----HTH_CROC1 PDB: A:13-67 UniProt: 13-67 --------------------------- PROSITE (2) Transcript --------------------------------------------------------------------------------------- Transcript 2icp A 8 RPGDIIQESLDELNVSLREFARAmEIAPSTASRLLTGKAALTPEmAIKLSVVIGSSPQmWLNLQNAWSLAEAEKTVDVSRLRRLVTQ 94 17 27 | 37 47 | 57 67 77 87 31-MSE 52-MSE 66-MSE Chain A from PDB Type:PROTEIN Length:87 aligned with YDDM_ECOLI | P67699 from UniProtKB/Swiss-Prot Length:94 Alignment length:87 17 27 37 47 57 67 77 87 YDDM_ECOLI 8 RPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNAWSLAEAEKTVDVSRLRRLVTQ 94 SCOP domains d2icpa1 A:8-94 Antitoxin HigA SCOP domains CATH domains 2icpA01 A:8-82 lambda repressor-like DNA-binding domains ------------ CATH domains Pfam domains --------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -----HTH_CROC1 PDB: A:13-67 UniProt: 13-67 --------------------------- PROSITE Transcript --------------------------------------------------------------------------------------- Transcript 2icp A 8 RPGDIIQESLDELNVSLREFARAmEIAPSTASRLLTGKAALTPEmAIKLSVVIGSSPQmWLNLQNAWSLAEAEKTVDVSRLRRLVTQ 94 17 27 | 37 47 | 57 67 77 87 31-MSE 52-MSE 66-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (1, 1)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2ICP) |
Gene Ontology (4, 8)|
Asymmetric Unit(hide GO term definitions) Chain A (YDDM_ECOL6 | P67700)
Chain A (YDDM_ECOLI | P67699)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|