|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 4) Biological Unit 1 (1, 3) Biological Unit 2 (1, 6) |
Asymmetric Unit (1, 1)
|
(no "SS Bond" information available for 2ICP) |
(no "Cis Peptide Bond" information available for 2ICP) |
(no "SAP(SNP)/Variant" information available for 2ICP) |
Asymmetric Unit (1, 1)
|
(no "Exon" information available for 2ICP) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:87 aligned with YDDM_ECOL6 | P67700 from UniProtKB/Swiss-Prot Length:94 Alignment length:87 17 27 37 47 57 67 77 87 YDDM_ECOL6 8 RPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNAWSLAEAEKTVDVSRLRRLVTQ 94 SCOP domains d2icpa1 A:8-94 Antitoxin HigA SCOP domains CATH domains 2icpA01 A:8-82 lambda repressor-like DNA-binding domains ------------ CATH domains Pfam domains --------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (2) -----HTH_CROC1 PDB: A:13-67 UniProt: 13-67 --------------------------- PROSITE (2) Transcript --------------------------------------------------------------------------------------- Transcript 2icp A 8 RPGDIIQESLDELNVSLREFARAmEIAPSTASRLLTGKAALTPEmAIKLSVVIGSSPQmWLNLQNAWSLAEAEKTVDVSRLRRLVTQ 94 17 27 | 37 47 | 57 67 77 87 31-MSE 52-MSE 66-MSE Chain A from PDB Type:PROTEIN Length:87 aligned with YDDM_ECOLI | P67699 from UniProtKB/Swiss-Prot Length:94 Alignment length:87 17 27 37 47 57 67 77 87 YDDM_ECOLI 8 RPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNAWSLAEAEKTVDVSRLRRLVTQ 94 SCOP domains d2icpa1 A:8-94 Antitoxin HigA SCOP domains CATH domains 2icpA01 A:8-82 lambda repressor-like DNA-binding domains ------------ CATH domains Pfam domains --------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -----HTH_CROC1 PDB: A:13-67 UniProt: 13-67 --------------------------- PROSITE Transcript --------------------------------------------------------------------------------------- Transcript 2icp A 8 RPGDIIQESLDELNVSLREFARAmEIAPSTASRLLTGKAALTPEmAIKLSVVIGSSPQmWLNLQNAWSLAEAEKTVDVSRLRRLVTQ 94 17 27 | 37 47 | 57 67 77 87 31-MSE 52-MSE 66-MSE
|
Asymmetric Unit |
Asymmetric Unit |
(no "Pfam Domain" information available for 2ICP) |
Asymmetric Unit(hide GO term definitions) Chain A (YDDM_ECOL6 | P67700)
Chain A (YDDM_ECOLI | P67699)
|
|
|
|
|
|
|