|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 2)
|
Asymmetric Unit (2, 2)
|
Asymmetric Unit
|
Asymmetric Unit
|
(no "SAP(SNP)/Variant" information available for 2F5Y) |
Asymmetric Unit (1, 2)
|
Asymmetric UnitChain A from PDB Type:PROTEIN Length:82 aligned with RGS3_HUMAN | P49796 from UniProtKB/Swiss-Prot Length:1198 Alignment length:105 281 291 301 311 321 331 341 351 361 371 RGS3_HUMAN 272 ARRRLRPLRDPLLRMPGGGDTENGKKLKITIPRGKDGFGFTICCDSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPVEHWKCVELAHEIRSCPSEIILLVWRMV 376 SCOP domains ----------------------------d2f5ya1 A:19-95 Regulator of G-protein signaling 3, RGS3 SCOP domains CATH domains --------------------------------------------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------PDZ PDB: A:19-95 UniProt: 299-376 PROSITE Transcript 1 (1) Exon 1.11 ------------------Exon 1.16b PDB: A:19-46 ----------------------------------Exon 1.18c Transcript 1 (1) Transcript 1 (2) ---------Exon 1.12 ---------------------------Exon 1.17 PDB: A:46-81 -------------- Transcript 1 (2) 2f5y A 14 MRYR-----------------------QITIPRGKDGFGFTICCDSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPVEHWKCVELAHEIRSCPSEIILLVWRMV 95 | - - |20 30 40 50 60 70 80 90 17 18 Chain B from PDB Type:PROTEIN Length:82 aligned with RGS3_HUMAN | P49796 from UniProtKB/Swiss-Prot Length:1198 Alignment length:105 281 291 301 311 321 331 341 351 361 371 RGS3_HUMAN 272 ARRRLRPLRDPLLRMPGGGDTENGKKLKITIPRGKDGFGFTICCDSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPVEHWKCVELAHEIRSCPSEIILLVWRMV 376 SCOP domains d2f5 yb_ B: Regulator of G-protein signaling 3, RGS3 SCOP domains CATH domains --------------------------------------------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------PDZ PDB: B:19-95 UniProt: 299-376 PROSITE Transcript 1 (1) Exon 1.11 ------------------Exon 1.16b PDB: B:19-46 ----------------------------------Exon 1.18c Transcript 1 (1) Transcript 1 (2) ---------Exon 1.12 ---------------------------Exon 1.17 PDB: B:46-81 -------------- Transcript 1 (2) 2f5y B 14 MRYR-----------------------QITIPRGKDGFGFTICCDSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPVEHWKCVELAHEIRSCPSEIILLVWRMV 95 | - - |20 30 40 50 60 70 80 90 17 18
|
Asymmetric Unit
|
(no "CATH Domain" information available for 2F5Y) |
(no "Pfam Domain" information available for 2F5Y) |
Asymmetric Unit(hide GO term definitions) Chain A,B (RGS3_HUMAN | P49796)
|
|
|
|
|
|
|