2OJ4 - JenaLib

Asym./Biol. Unit - manually

Asym./Biol. Unit

collapse

expand

Asym./Biol. Unit - manually (Jmol Viewer)

Asym./Biol. Unit (Jmol Viewer)

Description

Title :   CRYSTAL STRUCTURE OF RGS3 RGS DOMAIN

Authors :   E. Boura, T. Obsil

Date :   12 Jan 07 (Deposition) - 30 Jan 07 (Release) - 19 May 10 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.30

Chains :   Asym./Biol. Unit : A

Keywords :   Protein; Rgs Domain, Signaling Protein Inhibitor (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   L. Rezabkova, E. Boura, P. Herman, J. Vecer, L. Bourova, M. Sulc, P. Svoboda, V. Obsilova, T. Obsil
14-3-3 Protein Interacts With And Affects The Structure Of Rgs Domain Of Regulator Of G Protein Signaling 3 (Rgs3).
J. Struct. Biol. V. 170 451 2010
PubMed-ID: 20347994 | Reference-DOI: 10.1016/J.JSB.2010.03.009

Compounds

Molecule 1 - REGULATOR OF G-PROTEIN SIGNALING 3
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PET15B
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Fragment	:	RGS DOMAIN
	Gene	:	RGS3
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	RGS3; RGP3

Structural Features

Chains, Units

		1
Asymmetric/Biological Unit	:	A

Summary Information (see also Sequences/Alignments below)

Ligands, Modified Residues, Ions (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2OJ4)

Sites (0, 0)

(no "Site" information available for 2OJ4)

SS Bonds (1, 1)

Asymmetric/Biological Unit

No.	Residues
1	A:73	-	A:73

Cis Peptide Bonds (0, 0)

(no "Cis Peptide Bond" information available for 2OJ4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

(no "SAP(SNP)/Variant" information available for 2OJ4)

PROSITE Motifs (1, 1)

Asymmetric/Biological Unit (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	RGS	PS50132	RGS domain profile.	RGS3_HUMAN	1073-1189	1	A:11-127

Exons (3, 3)

Asymmetric/Biological Unit (3, 3)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000374140	1	ENSE00001938738	chr9:116207011-116207207	197	RGS3_HUMAN	-	0	0	-	-
1.2a	ENST00000374140	2a	ENSE00001923205	chr9:116222525-116222616	92	RGS3_HUMAN	1-27	27	0	-	-
1.3b	ENST00000374140	3b	ENSE00001462643	chr9:116223987-116224140	154	RGS3_HUMAN	27-78	52	0	-	-
1.4	ENST00000374140	4	ENSE00001748508	chr9:116224301-116224481	181	RGS3_HUMAN	79-139	61	0	-	-
1.6c	ENST00000374140	6c	ENSE00001695107	chr9:116241771-116241821	51	RGS3_HUMAN	139-156	18	0	-	-
1.7b	ENST00000374140	7b	ENSE00001591902	chr9:116245339-116245397	59	RGS3_HUMAN	156-175	20	0	-	-
1.8	ENST00000374140	8	ENSE00001723744	chr9:116246418-116246512	95	RGS3_HUMAN	176-207	32	0	-	-
1.9b	ENST00000374140	9b	ENSE00001791421	chr9:116247905-116247973	69	RGS3_HUMAN	207-230	24	0	-	-
1.10b	ENST00000374140	10b	ENSE00001735908	chr9:116258066-116258126	61	RGS3_HUMAN	230-250	21	0	-	-
1.11	ENST00000374140	11	ENSE00001625292	chr9:116259594-116259684	91	RGS3_HUMAN	251-281	31	0	-	-
1.12	ENST00000374140	12	ENSE00001594147	chr9:116260305-116260360	56	RGS3_HUMAN	281-299	19	0	-	-
1.16b	ENST00000374140	16b	ENSE00001703355	chr9:116267722-116267803	82	RGS3_HUMAN	300-327	28	0	-	-
1.17	ENST00000374140	17	ENSE00001785995	chr9:116268668-116268773	106	RGS3_HUMAN	327-362	36	0	-	-
1.18c	ENST00000374140	18c	ENSE00001783167	chr9:116269567-116269918	352	RGS3_HUMAN	362-479	118	0	-	-
1.19	ENST00000374140	19	ENSE00001645856	chr9:116270821-116270860	40	RGS3_HUMAN	480-493	14	0	-	-
1.20	ENST00000374140	20	ENSE00001780945	chr9:116276738-116276934	197	RGS3_HUMAN	493-558	66	0	-	-
1.22b	ENST00000374140	22b	ENSE00001624107	chr9:116279821-116279904	84	RGS3_HUMAN	559-586	28	0	-	-
1.25	ENST00000374140	25	ENSE00001755698	chr9:116285210-116285321	112	RGS3_HUMAN	587-624	38	0	-	-
1.26	ENST00000374140	26	ENSE00001786061	chr9:116291501-116291544	44	RGS3_HUMAN	624-638	15	0	-	-
1.27d	ENST00000374140	27d	ENSE00001747014	chr9:116299076-116299198	123	RGS3_HUMAN	639-679	41	0	-	-
1.31n	ENST00000374140	31n	ENSE00001717471	chr9:116345730-116346707	978	RGS3_HUMAN	680-1005	326	0	-	-
1.32a	ENST00000374140	32a	ENSE00001696453	chr9:116353613-116353677	65	RGS3_HUMAN	1006-1027	22	0	-	-
1.33c	ENST00000374140	33c	ENSE00002113884	chr9:116356710-116356811	102	RGS3_HUMAN	1027-1061	35	0	-	-
1.34a	ENST00000374140	34a	ENSE00002187394	chr9:116357199-116357260	62	RGS3_HUMAN	1061-1082	22	1	A:2-20	19
1.35c	ENST00000374140	35c	ENSE00002127856	chr9:116357879-116358045	167	RGS3_HUMAN	1082-1137	56	1	A:20-75	56
1.36c	ENST00000374140	36c	ENSE00001434265	chr9:116359048-116360018	971	RGS3_HUMAN	1138-1198	61	1	A:76-128	53

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:127
 aligned with RGS3_HUMAN | P49796 from UniProtKB/Swiss-Prot  Length:1198

    Alignment length:127
                                  1073      1083      1093      1103      1113      1123      1133      1143      1153      1163      1173      1183       
          RGS3_HUMAN   1064 SEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLIN 1190
               SCOP domains d2oj4a_ A: automated matches                                                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------RGS-2oj4A01 A:11-126                                                                                                -- Pfam domains
         Sec.struct. author .hhhhhhh.hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh..........hhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------RGS  PDB: A:11-127 UniProt: 1073-1189                                                                                - PROSITE
           Transcript 1 (1) Exon 1.34a         -------------------------------------------------------Exon 1.36c  PDB: A:76-128 UniProt: 1138-1198          Transcript 1 (1)
           Transcript 1 (2) ------------------Exon 1.35c  PDB: A:20-75 UniProt: 1082-1137             ----------------------------------------------------- Transcript 1 (2)
                2oj4 A    2 SEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLIN  128
                                    11        21        31        41        51        61        71        81        91       101       111       121

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: Regulator of G-protein signaling, RGS (52)

Superfamily: Regulator of G-protein signaling, RGS (52)

Family: automated matches (25)

Protein domain: automated matches (25)

Human (Homo sapiens) [TaxId: 9606] (24)

d2oj4a_

CATH Domains (0, 0)

(no "CATH Domain" information available for 2OJ4)

Pfam Domains (1, 1)

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: RGS (17)

Family: RGS (16)

Homo sapiens (Human) (9)

RGS-2oj4A01

A:11-126

Gene Ontology (12, 12)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (RGS3_HUMAN | P49796)

molecular function
	GO:0005096	GTPase activator activity	Binds to and increases the activity of a GTPase, an enzyme that catalyzes the hydrolysis of GTP.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0000188	inactivation of MAPK activity	Any process that terminates the activity of the active enzyme MAP kinase.
	GO:0009968	negative regulation of signal transduction	Any process that stops, prevents, or reduces the frequency, rate or extent of signal transduction.
	GO:0043547	positive regulation of GTPase activity	Any process that activates or increases the activity of a GTPase.
	GO:0008277	regulation of G-protein coupled receptor protein signaling pathway	Any process that modulates the frequency, rate or extent of G-protein coupled receptor protein signaling pathway activity.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2oj4)

	Sites
(no "Sites" information available for 2oj4)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2oj4)

Still Images

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2oj4
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	RGS3_HUMAN \| P49796
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	RGS3_HUMAN \| P49796
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
	RGS3_HUMAN \| P49796	:	2f5y 3fbk

Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2OJ4)