|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2EQU) |
Sites (0, 0)| (no "Site" information available for 2EQU) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2EQU) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2EQU) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2EQU) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2EQU) |
Exons (4, 4)
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:74 aligned with P20L1_HUMAN | A8MW92 from UniProtKB/Swiss-Prot Length:1017 Alignment length:117 70 80 90 100 110 120 130 140 150 160 170 P20L1_HUMAN 61 DSNRLRPLERPALRKEGLKDEEDFFDFKAGEEVLARWTDCRYYPAKIEAINKEGTFTVQFYDGVIRCLKRMHIKAMPEDAKGQVKSQHPLSWCCPIDPAGSCNQSMGSEDWIALVKA 177 SCOP domains --------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains --------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------------------------- PROSITE Transcript 1 (1) Exon 1.4 UniProt: 28-85 Exon 1.5 PDB: A:86-114 -----------------------------Exon 1.6e PDB: - 1.7b Transcript 1 (1) Transcript 1 (2) -----------------------------------------------------Exon 1.6b PDB: A:114-143 ---------------------------------- Transcript 1 (2) 2equ A 78 GSS-------------GSSG----FDFKAGEEVLARWTDCRYYPAKIEAINKEGTFTVQFYDGVIRCLKRMHIKAMPEDAKGQ--------------------------DWIALVKA 151 | - | 84 | 90 100 110 120 130 140 | - - 144 80 81 84 85 143 144
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2EQU) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2EQU) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2EQU) |
Gene Ontology (2, 2)|
NMR Structure(hide GO term definitions) Chain A (P20L1_HUMAN | A8MW92)
|
||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|