2E60 - JenaLib

NMR Structure - manually (Jmol Viewer)

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   SOLUTION STRUCTURE OF THE SURP1 DOMAIN IN SPLICING FACTOR, ARGININE/SERINE-RICH 8

Authors :   F. He, Y. Muto, M. Inoue, T. Kigawa, M. Shirouzu, T. Terada, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)

Date :   25 Dec 06 (Deposition) - 26 Jun 07 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)

Keywords :   Nmr, Surp Domain, Structural Genomics, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi, Rna Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   F. He, Y. Muto, M. Inoue, T. Kigawa, M. Shirouzu, T. Terada, S. Yokoyama
Solution Structure Of The Surp1 Domain In Splicing Factor, Arginine/Serine-Rich 8
To Be Published
PubMed: search
(for further references see the PDB file header)

Molecule 1 - SPLICING FACTOR, ARGININE/SERINE-RICH 8
	Chains	:	A
	Engineered	:	YES
	Expression System Plasmid	:	P060320-20
	Expression System Vector Type	:	PLASMID
	Fragment	:	SURP DOMAIN
	Gene	:	SFRS8, SWAP
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	CELL FREE PROTEIN SYNTHESIS
	Synonym	:	SFRS8 PROTEIN


NMR Structure (20x)	:

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2E60)

(no "Site" information available for 2E60)

(no "SS Bond" information available for 2E60)

(no "Cis Peptide Bond" information available for 2E60)

(no "SAP(SNP)/Variant" information available for 2E60)

NMR Structure (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SURP	PS50128	SURP motif repeat profile.	SFSWA_HUMAN	211-253 459-499	1	A:30-72 -

NMR Structure (4, 4)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000261674	1	ENSE00001192361	chr12:132195635-132195992	358	SFSWA_HUMAN	1-73	73	0	-	-
1.2	ENST00000261674	2	ENSE00000757545	chr12:132198616-132198785	170	SFSWA_HUMAN	73-130	58	0	-	-
1.3	ENST00000261674	3	ENSE00000757546	chr12:132199367-132199498	132	SFSWA_HUMAN	130-174	45	1	A:1-7	7
1.4	ENST00000261674	4	ENSE00000757547	chr12:132203999-132204084	86	SFSWA_HUMAN	174-202	29	1	A:8-21	14
1.5	ENST00000261674	5	ENSE00000757548	chr12:132209950-132210175	226	SFSWA_HUMAN	203-278	76	1	A:22-97	76
1.6	ENST00000261674	6	ENSE00000757549	chr12:132211485-132211597	113	SFSWA_HUMAN	278-315	38	1	A:97-101	5
1.7	ENST00000261674	7	ENSE00000757550	chr12:132212838-132212973	136	SFSWA_HUMAN	316-361	46	0	-	-
1.8	ENST00000261674	8	ENSE00001192354	chr12:132237668-132237908	241	SFSWA_HUMAN	361-441	81	0	-	-
1.9	ENST00000261674	9	ENSE00000757553	chr12:132238913-132239044	132	SFSWA_HUMAN	441-485	45	0	-	-
1.10	ENST00000261674	10	ENSE00000757554	chr12:132239931-132240024	94	SFSWA_HUMAN	485-516	32	0	-	-
1.11	ENST00000261674	11	ENSE00000757555	chr12:132241018-132241189	172	SFSWA_HUMAN	517-574	58	0	-	-
1.12	ENST00000261674	12	ENSE00000757556	chr12:132249001-132249231	231	SFSWA_HUMAN	574-651	78	0	-	-
1.13	ENST00000261674	13	ENSE00001192340	chr12:132250663-132250853	191	SFSWA_HUMAN	651-714	64	0	-	-
1.14	ENST00000261674	14	ENSE00001222569	chr12:132262610-132262875	266	SFSWA_HUMAN	715-803	89	0	-	-
1.15	ENST00000261674	15	ENSE00001297565	chr12:132271008-132271133	126	SFSWA_HUMAN	803-845	43	0	-	-
1.16	ENST00000261674	16	ENSE00001318201	chr12:132281723-132281905	183	SFSWA_HUMAN	845-906	62	0	-	-
1.17	ENST00000261674	17	ENSE00001290833	chr12:132283582-132283654	73	SFSWA_HUMAN	906-930	25	0	-	-
1.18	ENST00000261674	18	ENSE00001305898	chr12:132283968-132284282	315	SFSWA_HUMAN	931-951	21	0	-	-

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:101
 aligned with Q8IV81_HUMAN | Q8IV81 from UniProtKB/TrEMBL  Length:547

    Alignment length:139
                                    90       100       110       120       130       140       150       160       170       180       190       200       210         
         Q8IV81_HUMAN    81 GSYNAVGFTYGSDYYDPSEPTEEEEPSKQREKNEAENLEENEEPFVAPLGLSVPSDVELPPTAKMHAIIERTASFVCRQGAQFEIMLKAKQARNSQFDFLRFDHYLNPYYKFIQKAMKEGRYTVLAENKSDEKKKSGVS 219
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......--------------------------------------.................hhhhhhhhhhhhhhhh..hhhhhhhhhh.......hhh.....hhhhhhhhhhhhhh.................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2e60 A   1 GSSGSSG--------------------------------------VAPLGLSVPSDVELPPTAKMHAIIERTASFVCRQGAQFEIMLKAKQARNSQFDFLRFDHYLNPYYKFIQKAMKEGRYTVLAENKSDEKKKSGVS 101
                                  |  -         -         -         -     |  12        22        32        42        52        62        72        82        92         
                                  7                                      8

Chain A from PDB  Type:PROTEIN  Length:101
 aligned with SFSWA_HUMAN | Q12872 from UniProtKB/Swiss-Prot  Length:951

    Alignment length:139
                                   153       163       173       183       193       203       213       223       233       243       253       263       273         
          SFSWA_HUMAN   144 GSYNAVGFTYGSDYYDPSEPTEEEEPSKQREKNEAENLEENEEPFVAPLGLSVPSDVELPPTAKMHAIIERTASFVCRQGAQFEIMLKAKQARNSQFDFLRFDHYLNPYYKFIQKAMKEGRYTVLAENKSDEKKKSGVS 282
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......--------------------------------------.................hhhhhhhhhhhhhhhh..hhhhhhhhhh.......hhh.....hhhhhhhhhhhhhh.................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------SURP  PDB: A:30-72 UniProt: 211-253        ----------------------------- PROSITE
           Transcript 1 (1) Exon 1.3  PDB: A:1-7           ----------------------------Exon 1.5  PDB: A:22-97 UniProt: 203-278                                     ---- Transcript 1 (1)
           Transcript 1 (2) ------------------------------Exon 1.4  PDB: A:8-21        ---------------------------------------------------------------------------1.6   Transcript 1 (2)
                 2e60 A   1 GSSGSSG--------------------------------------VAPLGLSVPSDVELPPTAKMHAIIERTASFVCRQGAQFEIMLKAKQARNSQFDFLRFDHYLNPYYKFIQKAMKEGRYTVLAENKSDEKKKSGVS 101
                                  |  -         -         -         -     |  12        22        32        42        52        62        72        82        92         
                                  7                                      8

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 2E60)

(no "CATH Domain" information available for 2E60)

(no "Pfam Domain" information available for 2E60)

NMR Structure(hide GO term definitions)

Chain A (Q8IV81_HUMAN | Q8IV81)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
biological process
	GO:0006396	RNA processing	Any process involved in the conversion of one or more primary RNA transcripts into one or more mature RNA molecules.

Chain A (SFSWA_HUMAN | Q12872)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0006396	RNA processing	Any process involved in the conversion of one or more primary RNA transcripts into one or more mature RNA molecules.
	GO:0008380	RNA splicing	The process of removing sections of the primary RNA transcript to remove sequences not present in the mature form of the RNA and joining the remaining sections to form the mature form of the RNA.
	GO:0000380	alternative mRNA splicing, via spliceosome	The process of generating multiple mRNA molecules from a given set of exons by differential use of exons from the primary transcript(s) to form multiple mature mRNAs that vary in their exon composition.
	GO:0000395	mRNA 5'-splice site recognition	Recognition of the intron 5'-splice site by components of the assembling spliceosome.
	GO:0006397	mRNA processing	Any process involved in the conversion of a primary mRNA transcript into one or more mature mRNA(s) prior to translation into polypeptide.
	GO:0048025	negative regulation of mRNA splicing, via spliceosome	Any process that stops, prevents or reduces the rate or extent of mRNA splicing via a spliceosomal mechanism.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2e60)

	Sites
(no "Sites" information available for 2e60)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2e60)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2e60
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	Q8IV81_HUMAN \| Q8IV81
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	SFSWA_HUMAN \| Q12872
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	Q8IV81_HUMAN \| Q8IV81
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	SFSWA_HUMAN \| Q12872
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	Q8IV81_HUMAN \| Q8IV81	:	2e5z
	SFSWA_HUMAN \| Q12872	:	2e5z

(no "Related Entries Specified in the PDB File" available for 2E60)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 1)

Exons (4, 4)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (11, 13)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File