|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2E5Z) |
Sites (0, 0)| (no "Site" information available for 2E5Z) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2E5Z) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2E5Z) |
SAPs(SNPs)/Variants (1, 1)
NMR Structure (1, 1)
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (4, 4)
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:90 aligned with Q8IV81_HUMAN | Q8IV81 from UniProtKB/TrEMBL Length:547 Alignment length:94 375 385 395 405 415 425 435 445 455 Q8IV81_HUMAN 366 TSSGATSTTTTTSALAPVAAIIPPPPDVQPVIDKLAEYVARNGLKFETSVRAKNDQRFEFLQPWHQYNAYYEFKKQFFLQKEGGDSMQAVSAPE 459 SCOP domains ---------------------------------------------------------------------------------------------- SCOP domains CATH domains ---------------------------------------------------------------------------------------------- CATH domains Pfam domains ---------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -----------------------------------------------------------------------------------S---------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------- Transcript 2e5z A 1 GSSGSSG----TSALAPVAAIIPPPPDVQPVIDKLAEYVARNGLKFETSVRAKNDQRFEFLQPWHQYNAYYEFKKQFFLQKEGGDSMQAVSAPE 90 | - | 16 26 36 46 56 66 76 86 7 8 Chain A from PDB Type:PROTEIN Length:90 aligned with SFSWA_HUMAN | Q12872 from UniProtKB/Swiss-Prot Length:951 Alignment length:94 438 448 458 468 478 488 498 508 518 SFSWA_HUMAN 429 TSSGATSTTTTTSALAPVAAIIPPPPDVQPVIDKLAEYVARNGLKFETSVRAKNDQRFEFLQPWHQYNAYYEFKKQFFLQKEGGDSMQAVSAPE 522 SCOP domains ---------------------------------------------------------------------------------------------- SCOP domains CATH domains ---------------------------------------------------------------------------------------------- CATH domains Pfam domains ---------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -----------------------------------------------------------------------------------S---------- SAPs(SNPs) PROSITE ------------------------------SURP PDB: A:27-67 UniProt: 459-499 ----------------------- PROSITE Transcript 1 (1) Exon 1.8 -------------------------------------------Exon 1.10 PDB: A:53-84 1.11 Transcript 1 (1) Transcript 1 (2) ------------Exon 1.9 PDB: A:9-53 UniProt: 441-485 ------------------------------------- Transcript 1 (2) 2e5z A 1 GSSGSSG----TSALAPVAAIIPPPPDVQPVIDKLAEYVARNGLKFETSVRAKNDQRFEFLQPWHQYNAYYEFKKQFFLQKEGGDSMQAVSAPE 90 | - | 16 26 36 46 56 66 76 86 7 8
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2E5Z) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2E5Z) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2E5Z) |
Gene Ontology (11, 13)|
NMR Structure(hide GO term definitions) Chain A (SFSWA_HUMAN | Q12872)
Chain A (Q8IV81_HUMAN | Q8IV81)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|