|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 3)
Asymmetric Unit (1, 3)
|
Sites (3, 3)
Asymmetric Unit (3, 3)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2CPG) |
Cis Peptide Bonds (1, 1)
Asymmetric Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2CPG) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2CPG) |
Exons (0, 0)| (no "Exon" information available for 2CPG) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:43 aligned with COPG_STRAG | P13920 from UniProtKB/Swiss-Prot Length:45 Alignment length:43 10 20 30 40 COPG_STRAG 1 MKKRLTITLSESVLENLEKMAREMGLSKSAMISVALENYKKGQ 43 SCOP domains d2cpga_ A: Transcriptional repressor CopG SCOP domains CATH domains 2cpgA00 A:1-43 Met repressor-like CATH domains Pfam domains ------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------- PROSITE Transcript ------------------------------------------- Transcript 2cpg A 1 MKKRLTITLSESVLENLEKMAREMGLSKSAMISVALENYKKGQ 43 10 20 30 40 Chain B from PDB Type:PROTEIN Length:45 aligned with COPG_STRAG | P13920 from UniProtKB/Swiss-Prot Length:45 Alignment length:45 10 20 30 40 COPG_STRAG 1 MKKRLTITLSESVLENLEKMAREMGLSKSAMISVALENYKKGQEK 45 SCOP domains d2cpgb_ B: Transcriptional repressor CopG SCOP domains CATH domains 2cpgB00 B:1-45 Met repressor-like CATH domains Pfam domains --------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------- PROSITE Transcript --------------------------------------------- Transcript 2cpg B 1 MKKRLTITLSESVLENLEKMAREMGLSKSAMISVALENYKKGQER 45 10 20 30 40 Chain C from PDB Type:PROTEIN Length:42 aligned with COPG_STRAG | P13920 from UniProtKB/Swiss-Prot Length:45 Alignment length:42 10 20 30 40 COPG_STRAG 1 MKKRLTITLSESVLENLEKMAREMGLSKSAMISVALENYKKG 42 SCOP domains d2cpgc_ C: Transcriptional repressor CopG SCOP domains CATH domains 2cpgC00 C:1-42 Met repressor-like CATH domains Pfam domains ------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------ PROSITE Transcript ------------------------------------------ Transcript 2cpg C 1 MKKRLTITLSESVLENLEKMAREMGLSKSAMISVALENYKKG 42 10 20 30 40
|
||||||||||||||||||||
SCOP Domains (1, 3)| Asymmetric Unit |
CATH Domains (1, 3)
Asymmetric Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2CPG) |
Gene Ontology (4, 4)|
Asymmetric Unit(hide GO term definitions) Chain A,B,C (COPG_STRAG | P13920)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|