![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 3)
|
Asymmetric Unit (3, 3)
|
(no "SS Bond" information available for 2CPG) |
Asymmetric Unit
|
(no "SAP(SNP)/Variant" information available for 2CPG) |
(no "PROSITE Motif" information available for 2CPG) |
(no "Exon" information available for 2CPG) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:43 aligned with COPG_STRAG | P13920 from UniProtKB/Swiss-Prot Length:45 Alignment length:43 10 20 30 40 COPG_STRAG 1 MKKRLTITLSESVLENLEKMAREMGLSKSAMISVALENYKKGQ 43 SCOP domains d2cpga_ A: Transcriptional repressor CopG SCOP domains CATH domains 2cpgA00 A:1-43 Met repressor-like CATH domains Pfam domains ------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------- PROSITE Transcript ------------------------------------------- Transcript 2cpg A 1 MKKRLTITLSESVLENLEKMAREMGLSKSAMISVALENYKKGQ 43 10 20 30 40 Chain B from PDB Type:PROTEIN Length:45 aligned with COPG_STRAG | P13920 from UniProtKB/Swiss-Prot Length:45 Alignment length:45 10 20 30 40 COPG_STRAG 1 MKKRLTITLSESVLENLEKMAREMGLSKSAMISVALENYKKGQEK 45 SCOP domains d2cpgb_ B: Transcriptional repressor CopG SCOP domains CATH domains 2cpgB00 B:1-45 Met repressor-like CATH domains Pfam domains --------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------- PROSITE Transcript --------------------------------------------- Transcript 2cpg B 1 MKKRLTITLSESVLENLEKMAREMGLSKSAMISVALENYKKGQER 45 10 20 30 40 Chain C from PDB Type:PROTEIN Length:42 aligned with COPG_STRAG | P13920 from UniProtKB/Swiss-Prot Length:45 Alignment length:42 10 20 30 40 COPG_STRAG 1 MKKRLTITLSESVLENLEKMAREMGLSKSAMISVALENYKKG 42 SCOP domains d2cpgc_ C: Transcriptional repressor CopG SCOP domains CATH domains 2cpgC00 C:1-42 Met repressor-like CATH domains Pfam domains ------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------ PROSITE Transcript ------------------------------------------ Transcript 2cpg C 1 MKKRLTITLSESVLENLEKMAREMGLSKSAMISVALENYKKG 42 10 20 30 40
|
Asymmetric Unit |
Asymmetric Unit
|
(no "Pfam Domain" information available for 2CPG) |
Asymmetric Unit(hide GO term definitions) Chain A,B,C (COPG_STRAG | P13920)
|
|
|
|
|
|
|