Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Biol.Unit 1 - manually
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Biol.Unit 1 - manually
Biol.Unit 1 - manually  (Jmol Viewer)
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  TRANSCRIPTIONAL REPRESSOR COPG/DNA COMPLEX
 
Authors :  F. X. Gomis-Rueth, M. Sola, P. Acebo, A. Parraga, A. Guasch, R. Eritja, A. Gonzalez, M. Espinosa, G. Del Solar, M. Coll
Date :  15 Nov 99  (Deposition) - 19 Nov 99  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.56
Chains :  Asym. Unit :  A,B,E,F
Biol. Unit 1:  A,B,E,F  (2x)
Keywords :  Transcriptional Repressor, Dna-Binding Protein, Plasmid, Protein-Dna Complex, Gene Regulation/Dna (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  F. X. Gomis-Ruth, M. Sola, P. Acebo, A. Parraga, A. Guasch, R. Eritja, A. Gonzalez, M. Espinosa, G. Del Solar, M. Coll
The Structure Of Plasmid-Encoded Transcriptional Repressor Copg Unliganded And Bound To Its Operator.
Embo J. V. 17 7404 1998
PubMed-ID: 9857196  |  Reference-DOI: 10.1093/EMBOJ/17.24.7404
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - DNA (5'- D(*CP*CP*CP*GP*TP*GP*CP*AP*CP*TP*CP*AP*AP*TP*GP*CP*AP*AP*T) -3')
    Chains: E
    Engineered: YES
    Synthetic: YES
 
Molecule 2 - DNA (5'- D(*GP*AP*TP*TP*GP*CP*AP*TP*TP*GP*AP*GP*TP*GP*CP*AP*CP*GP*G) -3')
    Chains: F
    Engineered: YES
    Synthetic: YES
 
Molecule 3 - TRANSCRIPTIONAL REPRESSOR COPG
    Cellular Location: PLASMID PMV158
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PMV158
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Fragment: DNA-BINDING PROTEIN
    Organism Scientific: STREPTOCOCCUS AGALACTIAE
    Organism Taxid: 1311
    Strain: PLS1
    Synonym: REPA PROTEIN

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABEF
Biological Unit 1 (2x): ABEF

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1B01)

(-) Sites  (0, 0)

(no "Site" information available for 1B01)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1B01)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1B01)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1B01)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1B01)

(-) Exons   (0, 0)

(no "Exon" information available for 1B01)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:43
 aligned with COPG_STRAG | P13920 from UniProtKB/Swiss-Prot  Length:45

    Alignment length:43
                                    10        20        30        40   
           COPG_STRAG     1 MKKRLTITLSESVLENLEKMAREMGLSKSAMISVALENYKKGQ  43
               SCOP domains d1b01a_ A: Transcriptional repressor CopG   SCOP domains
               CATH domains 1b01A00 A:1-43 Met repressor-like           CATH domains
               Pfam domains ------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeee.hhhhhhhhhhhhhh...hhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------- PROSITE
                 Transcript ------------------------------------------- Transcript
                 1b01 A   1 MKKRLTITLSESVLENLEKMAREMGLSKSAMISVALENYKKGQ  43
                                    10        20        30        40   


Chain B from PDB  Type:PROTEIN  Length:43
 aligned with COPG_STRAG | P13920 from UniProtKB/Swiss-Prot  Length:45

    Alignment length:43
                                    10        20        30        40   
           COPG_STRAG     1 MKKRLTITLSESVLENLEKMAREMGLSKSAMISVALENYKKGQ  43
               SCOP domains d1b01b_ B: Transcriptional repressor CopG   SCOP domains
               CATH domains 1b01B00 B:1-43 Met repressor-like           CATH domains
               Pfam domains ------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeehhhhhhhhhhhhhh...hhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------- PROSITE
                 Transcript ------------------------------------------- Transcript
                 1b01 B   1 MKKRLTITLSESVLENLEKMAREMGLSKSAMISVALENYKKGQ  43
                                    10        20        30        40   


Chain E from PDB  Type:DNA  Length:19
                                                   
                 1b01 E 101 CCCGTGCACTCAATGCAAT 119
                                   110         


Chain F from PDB  Type:DNA  Length:19
                                                   
                 1b01 F 101 GATTGCATTGAGTGCACGG 119
                                   110
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1B01)

(-) Gene Ontology  (4, 4)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (COPG_STRAG | P13920)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
biological process
    GO:0006276    plasmid maintenance    The maintenance of the integrity of extrachromosomal plasmid DNA; includes processes that ensure plasmids are retained in the daughter cells after cell division.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1b01)
 
  Sites
(no "Sites" information available for 1b01)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1b01)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1b01
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  COPG_STRAG | P13920
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  COPG_STRAG | P13920
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        COPG_STRAG | P13920: 1ea4 2cpg

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1B01)