|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1B01) |
(no "Site" information available for 1B01) |
(no "SS Bond" information available for 1B01) |
(no "Cis Peptide Bond" information available for 1B01) |
(no "SAP(SNP)/Variant" information available for 1B01) |
(no "PROSITE Motif" information available for 1B01) |
(no "Exon" information available for 1B01) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:43 aligned with COPG_STRAG | P13920 from UniProtKB/Swiss-Prot Length:45 Alignment length:43 10 20 30 40 COPG_STRAG 1 MKKRLTITLSESVLENLEKMAREMGLSKSAMISVALENYKKGQ 43 SCOP domains d1b01a_ A: Transcriptional repressor CopG SCOP domains CATH domains 1b01A00 A:1-43 Met repressor-like CATH domains Pfam domains ------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------- PROSITE Transcript ------------------------------------------- Transcript 1b01 A 1 MKKRLTITLSESVLENLEKMAREMGLSKSAMISVALENYKKGQ 43 10 20 30 40 Chain B from PDB Type:PROTEIN Length:43 aligned with COPG_STRAG | P13920 from UniProtKB/Swiss-Prot Length:45 Alignment length:43 10 20 30 40 COPG_STRAG 1 MKKRLTITLSESVLENLEKMAREMGLSKSAMISVALENYKKGQ 43 SCOP domains d1b01b_ B: Transcriptional repressor CopG SCOP domains CATH domains 1b01B00 B:1-43 Met repressor-like CATH domains Pfam domains ------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------- PROSITE Transcript ------------------------------------------- Transcript 1b01 B 1 MKKRLTITLSESVLENLEKMAREMGLSKSAMISVALENYKKGQ 43 10 20 30 40 Chain E from PDB Type:DNA Length:19 1b01 E 101 CCCGTGCACTCAATGCAAT 119 110 Chain F from PDB Type:DNA Length:19 1b01 F 101 GATTGCATTGAGTGCACGG 119 110
|
Asymmetric Unit |
Asymmetric Unit
|
(no "Pfam Domain" information available for 1B01) |
Asymmetric Unit(hide GO term definitions) Chain A,B (COPG_STRAG | P13920)
|
|
|
|
|
|
|