|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2CJJ) |
Sites (0, 0)| (no "Site" information available for 2CJJ) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2CJJ) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2CJJ) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2CJJ) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2CJJ) |
Exons (0, 0)| (no "Exon" information available for 2CJJ) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:63 aligned with RAD_ANTMA | Q58FS3 from UniProtKB/Swiss-Prot Length:93 Alignment length:63 17 27 37 47 57 67 RAD_ANTMA 8 GRPWSAKENKAFERALAVYDKDTPDRWANVARAVEGRTPEEVKKHYEILVEDIKYIESGKVPF 70 SCOP domains d2cjja1 A:8-70 Radialis SCOP domains CATH domains --------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------- Transcript 2cjj A 8 GRPWSAKENKAFERALAVYDKDTPDRWANVARAVEGRTPEEVKKHYEILVEDIKYIESGKVPF 70 17 27 37 47 57 67
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2CJJ) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2CJJ) |
Gene Ontology (7, 7)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (RAD_ANTMA | Q58FS3)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|