2C46 - JenaLib

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Biological Unit 5 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF THE HUMAN RNA GUANYLYLTRANSFERASE AND 5'-PHOSPHATASE

Authors :   J. Debreczeni, C. Johansson, E. Longman, O. Gileadi, P. Savitskysmee, G. Bunkoczi, E. Ugochukwu, F. Von Delft, M. Sundstrom, J. Weigelt, C. Arrowsmith, A. Edwards, S. Knapp

Date :   15 Oct 05 (Deposition) - 01 Nov 05 (Release) - 05 Dec 12 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.60

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,B,C,D  (1x)
Biol. Unit 2: A  (1x)
Biol. Unit 3: B  (1x)
Biol. Unit 4: C  (1x)
Biol. Unit 5: D  (1x)

Keywords :   Phosphatase, Transferase, Hydrolase, Mrna Processing, Multifunctional Enzyme, Nucleotidyltransferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. Debreczeni, C. Johansson, E. Longman, O. Gileadi, P. Savitskysmee C. Smee, G. Bunkoczi, E. Ugochukwu, F. Von Delft, M. Sundstrom, J. Weigelt, C. Arrowsmith, A. Edwards, S. Knapp
Crystal Structure Of The Human Rna Guanylyltransferase And 5'-Phosphatase
To Be Published
PubMed: search

Molecule 1 - MRNA CAPPING ENZYME
	Chains	:	A, B, C, D
	EC Number	:	2.7.7.50
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Strain	:	BL21
	Expression System Taxid	:	511693
	Fragment	:	TPASE REGION, RESIDUES 1-219
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	HUMAN RNA GUANYLYLTRANSFERASE AND 5'-PHOSPHATASE, HCE, HCAP1

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A	B	C	D
Biological Unit 2 (1x)	:	A
Biological Unit 3 (1x)	:		B
Biological Unit 4 (1x)	:			C
Biological Unit 5 (1x)	:				D

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2C46)

(no "Site" information available for 2C46)

(no "SS Bond" information available for 2C46)

Asymmetric Unit

No.	Residues
1	Pro A:161	-	Pro A:162
2	Pro B:161	-	Pro B:162
3	Pro C:161	-	Pro C:162
4	Pro D:161	-	Pro D:162

(no "SAP(SNP)/Variant" information available for 2C46)

Asymmetric Unit (2, 8)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TYR_PHOSPHATASE_2	PS50056	Tyrosine specific protein phosphatases family profile.	MCE1_HUMAN	104-171	4	A:104-171 B:104-171 C:104-171 D:104-171
2	TYR_PHOSPHATASE_1	PS00383	Tyrosine specific protein phosphatases active site.	MCE1_HUMAN	124-134	4	A:124-134 B:124-134 C:124-134 D:124-134

Biological Unit 1 (2, 8)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TYR_PHOSPHATASE_2	PS50056	Tyrosine specific protein phosphatases family profile.	MCE1_HUMAN	104-171	4	A:104-171 B:104-171 C:104-171 D:104-171
2	TYR_PHOSPHATASE_1	PS00383	Tyrosine specific protein phosphatases active site.	MCE1_HUMAN	124-134	4	A:124-134 B:124-134 C:124-134 D:124-134

Biological Unit 2 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TYR_PHOSPHATASE_2	PS50056	Tyrosine specific protein phosphatases family profile.	MCE1_HUMAN	104-171	1	A:104-171 - - -
2	TYR_PHOSPHATASE_1	PS00383	Tyrosine specific protein phosphatases active site.	MCE1_HUMAN	124-134	1	A:124-134 - - -

Biological Unit 3 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TYR_PHOSPHATASE_2	PS50056	Tyrosine specific protein phosphatases family profile.	MCE1_HUMAN	104-171	1	- B:104-171 - -
2	TYR_PHOSPHATASE_1	PS00383	Tyrosine specific protein phosphatases active site.	MCE1_HUMAN	124-134	1	- B:124-134 - -

Biological Unit 4 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TYR_PHOSPHATASE_2	PS50056	Tyrosine specific protein phosphatases family profile.	MCE1_HUMAN	104-171	1	- - C:104-171 -
2	TYR_PHOSPHATASE_1	PS00383	Tyrosine specific protein phosphatases active site.	MCE1_HUMAN	124-134	1	- - C:124-134 -

Biological Unit 5 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TYR_PHOSPHATASE_2	PS50056	Tyrosine specific protein phosphatases family profile.	MCE1_HUMAN	104-171	1	- - - D:104-171
2	TYR_PHOSPHATASE_1	PS00383	Tyrosine specific protein phosphatases active site.	MCE1_HUMAN	124-134	1	- - - D:124-134

Asymmetric Unit (6, 24)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1b	ENST00000369485	1b	ENSE00001829011	chr6:89673315-89673065	251	MCE1_HUMAN	1-22	22	4	A:1-22 B:-2-22 C:-2-22 D:4-22	22 22 22 19
1.2	ENST00000369485	2	ENSE00000760359	chr6:89650899-89650790	110	MCE1_HUMAN	22-58	37	4	A:22-58 B:22-58 C:22-58 D:22-56	37 37 37 35
1.3	ENST00000369485	3	ENSE00000760358	chr6:89638986-89638883	104	MCE1_HUMAN	59-93	35	4	A:59-93 B:59-93 C:59-93 D:59-93	35 35 35 35
1.4	ENST00000369485	4	ENSE00000798181	chr6:89638792-89638704	89	MCE1_HUMAN	93-123	31	4	A:93-123 (gaps) B:93-123 (gaps) C:93-123 (gaps) D:93-123 (gaps)	31 31 31 31
1.5	ENST00000369485	5	ENSE00000918695	chr6:89616159-89616084	76	MCE1_HUMAN	123-148	26	4	A:123-148 B:123-148 C:123-148 D:123-148	26 26 26 26
1.6	ENST00000369485	6	ENSE00000798180	chr6:89614674-89614434	241	MCE1_HUMAN	148-228	81	4	A:148-199 B:148-199 C:148-199 D:148-200	52 52 52 53
1.7	ENST00000369485	7	ENSE00000918694	chr6:89601634-89601525	110	MCE1_HUMAN	229-265	37	0	-	-
1.8	ENST00000369485	8	ENSE00000918693	chr6:89600315-89600214	102	MCE1_HUMAN	265-299	35	0	-	-
1.9	ENST00000369485	9	ENSE00000760356	chr6:89563483-89563348	136	MCE1_HUMAN	299-344	46	0	-	-
1.10	ENST00000369485	10	ENSE00000760355	chr6:89559545-89559474	72	MCE1_HUMAN	345-368	24	0	-	-
1.11	ENST00000369485	11	ENSE00000760354	chr6:89554240-89554076	165	MCE1_HUMAN	369-423	55	0	-	-
1.12	ENST00000369485	12	ENSE00000760353	chr6:89511351-89511283	69	MCE1_HUMAN	424-446	23	0	-	-
1.13	ENST00000369485	13	ENSE00000760352	chr6:89479593-89479493	101	MCE1_HUMAN	447-480	34	0	-	-
1.14a	ENST00000369485	14a	ENSE00000760351	chr6:89388138-89388072	67	MCE1_HUMAN	480-502	23	0	-	-
1.15	ENST00000369485	15	ENSE00000760350	chr6:89324114-89323991	124	MCE1_HUMAN	503-544	42	0	-	-
1.16b	ENST00000369485	16b	ENSE00001823083	chr6:89322601-89319985	2617	MCE1_HUMAN	544-597	54	0	-	-

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:200
 aligned with MCE1_HUMAN | O60942 from UniProtKB/Swiss-Prot  Length:597

    Alignment length:205
                                  1                                                                                                                                                                                                      
                                  |  4        14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194     
           MCE1_HUMAN     - ------MAHNKIPPRWLNCPRRGQPVAGRFLPLKTMLGPRYDSQVAEENRFHPSMLSNYLKSLKVKMGLLVDLTNTSRFYDRNDIEKEGIKYIKLQCKGHGECPTTENTETFIRLCERFNERNPPELIGVHCTHGFNRTGFLICAFLVEKMDWSIEAAVATFAQARPPGIYKGDYLKELFRRYGDIEEAPPPPLLPDWCFEDDED 199
               SCOP domains d2c46a_ A: automated matches                                                                                                                                                                                  SCOP domains
               CATH domains 2c46A00 A:-5-199 Protein tyrosine phosphatase superfamily                                                                                                                                                     CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhh........................eeee....hhhhhhhhhhhhh.hhhhhhhhhhhhh.eeeeeee.........hhhhhh...eeee..........hhhhhhhhhhhhh..-----.eeeeee....hhhhhhhhhhhhhhh...hhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhh................ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -------------------------------------------------------------------------------------------------------------TYR_PHOSPHATASE_2  PDB: A:104-171 UniProt: 104-171                  ---------------------------- PROSITE (1)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------TYR_PHOSPHA----------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) ------Exon 1.1b  PDB: A:1-22------------------------------------Exon 1.3  PDB: A:59-93             -----------------------------Exon 1.5  PDB: A:123-148  --------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ---------------------------Exon 1.2  PDB: A:22-58 UniProt: 22-58----------------------------------Exon 1.4  PDB: A:93-123 (gaps) ------------------------Exon 1.6  PDB: A:148-199 UniProt: 148-228            Transcript 1 (2)
                 2c46 A  -5 NLYFQSMAHNKIPPRWLNCPRRGQPVAGRFLPLKTMLGPRYDSQVAEENRFHPSMLSNYLKSLKVKMGLLVDLTNTSRFYDRNDIEKEGIKYIKLQCKGHGECPTTENTETFIRLCERF-----PELIGVHCTHGFNRTGFLICAFLVEKMDWSIEAAVATFAQARPPGIYKGDYLKELFRRYGDIEEAPPPPLLPDWCFEDDED 199
                                     4        14        24        34        44        54        64        74        84        94       104        |-    |  124       134       144       154       164       174       184       194     
                                                                                                                                                113   119

Chain B from PDB  Type:PROTEIN  Length:201
 aligned with MCE1_HUMAN | O60942 from UniProtKB/Swiss-Prot  Length:597

    Alignment length:203
                                1                                                                                                                                                                                                      
                                |    6        16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196   
           MCE1_HUMAN     - ----MAHNKIPPRWLNCPRRGQPVAGRFLPLKTMLGPRYDSQVAEENRFHPSMLSNYLKSLKVKMGLLVDLTNTSRFYDRNDIEKEGIKYIKLQCKGHGECPTTENTETFIRLCERFNERNPPELIGVHCTHGFNRTGFLICAFLVEKMDWSIEAAVATFAQARPPGIYKGDYLKELFRRYGDIEEAPPPPLLPDWCFEDDED 199
               SCOP domains d2c46b_ B: automated matches                                                                                                                                                                                SCOP domains
               CATH domains 2c46B00 B:-6-199 Protein tyrosine phosphatase superfamily                                                                                                                                                   CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh.....................eeee....hhhhh...hhhhh.hhhhhhhhhhhhh..eeeeee.........hhhhhh...eeee..........hhhhhhhhhhhhhhhhhh.--.eeeee....hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhh......hhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -----------------------------------------------------------------------------------------------------------TYR_PHOSPHATASE_2  PDB: B:104-171 UniProt: 104-171                  ---------------------------- PROSITE (1)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------------------------TYR_PHOSPHA----------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) ----Exon 1.1b  PDB: B:-2-2------------------------------------Exon 1.3  PDB: B:59-93             -----------------------------Exon 1.5  PDB: B:123-148  --------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) -------------------------Exon 1.2  PDB: B:22-58 UniProt: 22-58----------------------------------Exon 1.4  PDB: B:93-123 (gaps) ------------------------Exon 1.6  PDB: B:148-199 UniProt: 148-228            Transcript 1 (2)
                 2c46 B  -6 ENLYFQSNKIPPRWLNCPRRGQPVAGRFLPLKTMLGPRYDSQVAEENRFHPSMLSNYLKSLKVKMGLLVDLTNTSRFYDRNDIEKEGIKYIKLQCKGHGECPTTENTETFIRLCERFNERN--ELIGVHCTHGFNRTGFLICAFLVEKMDWSIEAAVATFAQARPPGIYKGDYLKELFRRYGDIEEAPPPPLLPDWCFEDDED 199
                                  || 6        16        26        36        46        56        66        76        86        96       106       116|  |   126       136       146       156       166       176       186       196   
                                  0|                                                                                                              117  |                                                                               
                                   4                                                                                                                 120

Chain C from PDB  Type:PROTEIN  Length:197
 aligned with MCE1_HUMAN | O60942 from UniProtKB/Swiss-Prot  Length:597

    Alignment length:203
                                1                                                                                                                                                                                                      
                                |    6        16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196   
           MCE1_HUMAN     - ----MAHNKIPPRWLNCPRRGQPVAGRFLPLKTMLGPRYDSQVAEENRFHPSMLSNYLKSLKVKMGLLVDLTNTSRFYDRNDIEKEGIKYIKLQCKGHGECPTTENTETFIRLCERFNERNPPELIGVHCTHGFNRTGFLICAFLVEKMDWSIEAAVATFAQARPPGIYKGDYLKELFRRYGDIEEAPPPPLLPDWCFEDDED 199
               SCOP domains d2c46c_ C: automated matches                                                                                                                                                                                SCOP domains
               CATH domains 2c46C00 C:-6-199 Protein tyrosine phosphatase superfamily                                                                                                                                                   CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh.....................eeee....hhhhhhhhhhhhh.hhhhhhhhhhhh...eeeeee........hhhhhhh...eeee..........hhhhhhhhhhhhhh.------.eeeee....hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhh......hhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -----------------------------------------------------------------------------------------------------------TYR_PHOSPHATASE_2  PDB: C:104-171 UniProt: 104-171                  ---------------------------- PROSITE (1)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------------------------TYR_PHOSPHA----------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) ----Exon 1.1b  PDB: C:-2-2------------------------------------Exon 1.3  PDB: C:59-93             -----------------------------Exon 1.5  PDB: C:123-148  --------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) -------------------------Exon 1.2  PDB: C:22-58 UniProt: 22-58----------------------------------Exon 1.4  PDB: C:93-123 (gaps) ------------------------Exon 1.6  PDB: C:148-199 UniProt: 148-228            Transcript 1 (2)
                 2c46 C  -6 ENLYFQSNKIPPRWLNCPRRGQPVAGRFLPLKTMLGPRYDSQVAEENRFHPSMLSNYLKSLKVKMGLLVDLTNTSRFYDRNDIEKEGIKYIKLQCKGHGECPTTENTETFIRLCERF------ELIGVHCTHGFNRTGFLICAFLVEKMDWSIEAAVATFAQARPPGIYKGDYLKELFRRYGDIEEAPPPPLLPDWCFEDDED 199
                                  || 6        16        26        36        46        56        66        76        86        96       106      |  -   |   126       136       146       156       166       176       186       196   
                                  0|                                                                                                          113    120                                                                               
                                   4

Chain D from PDB  Type:PROTEIN  Length:189
 aligned with MCE1_HUMAN | O60942 from UniProtKB/Swiss-Prot  Length:597

    Alignment length:197
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       
           MCE1_HUMAN     4 NKIPPRWLNCPRRGQPVAGRFLPLKTMLGPRYDSQVAEENRFHPSMLSNYLKSLKVKMGLLVDLTNTSRFYDRNDIEKEGIKYIKLQCKGHGECPTTENTETFIRLCERFNERNPPELIGVHCTHGFNRTGFLICAFLVEKMDWSIEAAVATFAQARPPGIYKGDYLKELFRRYGDIEEAPPPPLLPDWCFEDDEDE 200
               SCOP domains d2c46d_ D: automated matches                                                                                                                                                                          SCOP domains
               CATH domains 2c46D00 D:4-200 Protein tyrosine phosphatase superfam  ily                                                                                                                                            CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....................eeee....hhhhhhhhhhhhh.hhhhhhhhhhh--..eeeeee.........hhhhhh...eeee..........hhhhhhhhhhhhhh.------.eeeee....hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhh................. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----------------------------------------------------------------------------------------------------TYR_PHOSPHATASE_2  PDB: D:104-171 UniProt: 104-171                  ----------------------------- PROSITE (1)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------TYR_PHOSPHA------------------------------------------------------------------ PROSITE (2)
           Transcript 1 (1) Exon 1.1b          ------------------------------------Exon 1.3  PDB: D:59-93             -----------------------------Exon 1.5  PDB: D:123-148  ---------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ------------------Exon 1.2  PDB: D:22-56 UniProt: 22-58----------------------------------Exon 1.4  PDB: D:93-123 (gaps) ------------------------Exon 1.6  PDB: D:148-200 UniProt: 148-228             Transcript 1 (2)
                 2c46 D   4 NKIPPRWLNCPRRGQPVAGRFLPLKTMLGPRYDSQVAEENRFHPSMLSNYLKS--VKMGLLVDLTNTSRFYDRNDIEKEGIKYIKLQCKGHGECPTTENTETFIRLCERF------ELIGVHCTHGFNRTGFLICAFLVEKMDWSIEAAVATFAQARPPGIYKGDYLKELFRRYGDIEEAPPPPLLPDWCFEDDEDE 200
                                    13        23        33        43        53  |  |  63        73        83        93       103       113      |123       133       143       153       163       173       183       193       
                                                                               56 59                                                   113    120

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: (Phosphotyrosine protein) phosphatases II (296)

Superfamily: (Phosphotyrosine protein) phosphatases II (296)

Family: Dual specificity phosphatase-like (27)

Protein domain: automated matches (8)

Human (Homo sapiens) [TaxId: 9606] (6)

1a	d2c46a_	A:
1b	d2c46b_	B:
1c	d2c46c_	C:
1d	d2c46d_	D:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: Alpha-Beta Complex (3881)

Topology: Protein-Tyrosine Phosphatase; Chain A (262)

Homologous Superfamily: Protein tyrosine phosphatase superfamily (228)

Human (Homo sapiens) (196)

1a	2c46B00	B:-6-199
1b	2c46A00	A:-5-199
1c	2c46C00	C:-6-199
1d	2c46D00	D:4-200

(no "Pfam Domain" information available for 2C46)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (MCE1_HUMAN | O60942)

molecular function
	GO:0005525	GTP binding	Interacting selectively and non-covalently with GTP, guanosine triphosphate.
	GO:0008192	RNA guanylyltransferase activity	Catalysis of the posttranscriptional addition of a guanyl residue to the 5' end of an RNA molecule.
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0004484	mRNA guanylyltransferase activity	Catalysis of the reaction: GTP + (5')pp-Pur-mRNA = diphosphate + G(5')ppp-Pur-mRNA; G(5')ppp-Pur-mRNA is mRNA containing a guanosine residue linked 5' through three phosphates to the 5' position of the terminal residue.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0016779	nucleotidyltransferase activity	Catalysis of the transfer of a nucleotidyl group to a reactant.
	GO:0016791	phosphatase activity	Catalysis of the hydrolysis of phosphoric monoesters, releasing inorganic phosphate.
	GO:0004651	polynucleotide 5'-phosphatase activity	Catalysis of the reaction: 5'-phosphopolynucleotide + H2O = polynucleotide + phosphate.
	GO:0004725	protein tyrosine phosphatase activity	Catalysis of the reaction: protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
	GO:0008138	protein tyrosine/serine/threonine phosphatase activity	Catalysis of the reactions: protein serine + H2O = protein serine + phosphate; protein threonine phosphate + H2O = protein threonine + phosphate; and protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
	GO:0050355	triphosphatase activity	Catalysis of the reaction: H(2)O + triphosphate = diphosphate + phosphate.
biological process
	GO:0006370	7-methylguanosine mRNA capping	Addition of the 7-methylguanosine cap to the 5' end of a nascent messenger RNA transcript.
	GO:0006396	RNA processing	Any process involved in the conversion of one or more primary RNA transcripts into one or more mature RNA molecules.
	GO:0016311	dephosphorylation	The process of removing one or more phosphoric (ester or anhydride) residues from a molecule.
	GO:0006397	mRNA processing	Any process involved in the conversion of a primary mRNA transcript into one or more mature mRNA(s) prior to translation into polypeptide.
	GO:0008152	metabolic process	The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
	GO:0035335	peptidyl-tyrosine dephosphorylation	The removal of phosphoric residues from peptidyl-O-phospho-tyrosine to form peptidyl-tyrosine.
	GO:0098507	polynucleotide 5' dephosphorylation	The process of removing one or more phosphate groups from the 5' end of a polynucleotide.
	GO:0006470	protein dephosphorylation	The process of removing one or more phosphoric residues from a protein.
	GO:0006366	transcription from RNA polymerase II promoter	The synthesis of RNA from a DNA template by RNA polymerase II, originating at an RNA polymerase II promoter. Includes transcription of messenger RNA (mRNA) and certain small nuclear RNAs (snRNAs).
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2c46)

	Sites
(no "Sites" information available for 2c46)

	Cis Peptide Bonds
		Pro A:161 - Pro A:162	[ RasMol ]
		Pro B:161 - Pro B:162	[ RasMol ]
		Pro C:161 - Pro C:162	[ RasMol ]
		Pro D:161 - Pro D:162	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]
		Biological Unit 5	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format \| Biol. Unit 5 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2c46
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	MCE1_HUMAN \| O60942
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.7.7.50
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	MCE1_HUMAN \| O60942
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	MCE1_HUMAN \| O60942	:	3s24

(no "Related Entries Specified in the PDB File" available for 2C46)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 8)

Exons (6, 24)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (1, 4)

Pfam Domains (0, 0)

Gene Ontology (25, 25)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File