2C17 - JenaLib

Theoretical Model (Jmol Viewer)

Title :   COMPUTATIONAL MODEL OF HUMAN P450C17

Authors :   R. J. Auchus, W. L. Miller

Date :   02 Jun 99 (Deposition) - 19 Jul 99 (Release) - 01 Apr 03 (Revision)

Method :   THEORETICAL MODEL

Resolution :   NOT APPLICABLE

Chains :   Theor. Model : A,_^#
( ^#: chains that contain no standard or modified protein/DNA/RNA residue)

Keywords :   17-Alpha-Hydroxylase, 17/20-Lyase, P450C17, Sex Steroid Biosynthesis, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   R. J. Auchus, W. L. Miller
Molecular Modeling Of Human P450C17 (17Alpha-Hydroxylase/17, 20-Lyase): Insights Into Reaction Mechanisms And Effects Of Mutations.
Mol. Endocrinol. V. 13 1169 1999
PubMed: search
(for further references see the PDB file header)

Molecule 1 - PROTEIN (CYTOCHROME P450 XVIIA1)
	Chains	:	A
	EC Number	:	1.14.99.9
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Synonym	:	P450-C17, STEROID 17-ALPHA-HYDROXYLASE, 17/20- LYASE


Theoretical Model	:

( ^#: chains that contain no standard or modified protein/DNA/RNA residue)

Summary Information (see also Sequences/Alignments below)

Theoretical Model (1, 1)

No.	Name	Count	Type	Full Name
1	HEM	1	Ligand/Ion	PROTOPORPHYRIN IX CONTAINING FE

(no "Site" information available for 2C17)

(no "SS Bond" information available for 2C17)

Theoretical Model

No.	Residues
1	Ile A:40	-	Lys A:41
2	Ala A:83	-	Thr A:84
3	Lys A:94	-	Leu A:95

Theoretical Model (25, 25)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_001271	Y	64	S	CP17A_HUMAN	Disease (AH5)	---	A	Y	17	S
02	UniProt	VAR_013147	F	93	C	CP17A_HUMAN	Disease (AH5)	104894146	A	F	46	C
03	UniProt	VAR_073043	R	96	Q	CP17A_HUMAN	Disease (AH5)	104894153	A	R	49	Q
04	UniProt	VAR_022746	R	96	W	CP17A_HUMAN	Disease (AH5)	104894138	A	R	49	W
05	UniProt	VAR_001272	S	106	P	CP17A_HUMAN	Disease (AH5)	104894135	A	S	59	P
06	UniProt	VAR_022747	F	114	V	CP17A_HUMAN	Disease (AH5)	104894147	A	F	67	V
07	UniProt	VAR_022748	D	116	V	CP17A_HUMAN	Disease (AH5)	104894148	A	D	69	V
08	UniProt	VAR_073044	W	121	R	CP17A_HUMAN	Disease (AH5)	---	A	W	74	R
09	UniProt	VAR_073045	A	174	E	CP17A_HUMAN	Disease (AH5)	---	A	A	127	E
10	UniProt	VAR_022749	N	177	D	CP17A_HUMAN	Disease (AH5)	---	A	N	130	D
11	UniProt	VAR_022750	Y	329	D	CP17A_HUMAN	Disease (AH5)	104894144	A	Y	282	D
12	UniProt	VAR_001274	P	342	T	CP17A_HUMAN	Disease (AH5)	104894137	A	P	295	T
13	UniProt	VAR_022752	R	347	C	CP17A_HUMAN	Disease (AH5)	104894149	A	R	300	C
14	UniProt	VAR_001275	R	347	H	CP17A_HUMAN	Disease (AH5)	61754278	A	R	300	H
15	UniProt	VAR_001276	R	358	Q	CP17A_HUMAN	Disease (AH5)	104894139	A	R	311	Q
16	UniProt	VAR_022753	R	362	C	CP17A_HUMAN	Disease (AH5)	104894142	A	R	315	C
17	UniProt	VAR_001277	H	373	L	CP17A_HUMAN	Disease (AH5)	760695410	A	H	326	L
18	UniProt	VAR_073046	H	373	N	CP17A_HUMAN	Disease (AH5)	---	A	H	326	N
19	UniProt	VAR_073047	W	406	L	CP17A_HUMAN	Disease (AH5)	---	A	W	359	L
20	UniProt	VAR_022754	W	406	R	CP17A_HUMAN	Disease (AH5)	104894143	A	W	359	R
21	UniProt	VAR_022755	F	417	C	CP17A_HUMAN	Disease (AH5)	104894140	A	F	370	C
22	UniProt	VAR_022756	P	428	L	CP17A_HUMAN	Disease (AH5)	104894145	A	P	381	L
23	UniProt	VAR_001278	R	440	H	CP17A_HUMAN	Disease (AH5)	777638364	A	R	393	H
24	UniProt	VAR_001280	R	496	C	CP17A_HUMAN	Disease (AH5)	---	A	R	449	C
25	UniProt	VAR_022757	R	496	H	CP17A_HUMAN	Disease (AH5)	763398879	A	R	449	H

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Theoretical Model (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CYTOCHROME_P450	PS00086	Cytochrome P450 cysteine heme-iron ligand signature.	CP17A_HUMAN	435-444	1	A:388-397

Theoretical Model (8, 8)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000369887	1a	ENSE00001451182	chr10:104597290-104596822	469	CP17A_HUMAN	1-99	99	1	A:1-52	52
1.2b	ENST00000369887	2b	ENSE00000987437	chr10:104595149-104595011	139	CP17A_HUMAN	100-146	47	1	A:53-99	47
1.3a	ENST00000369887	3a	ENSE00000987438	chr10:104594771-104594542	230	CP17A_HUMAN	146-222	77	1	A:99-175	77
1.3d	ENST00000369887	3d	ENSE00000987439	chr10:104593879-104593793	87	CP17A_HUMAN	223-251	29	1	A:176-204	29
1.4a	ENST00000369887	4a	ENSE00000987440	chr10:104592965-104592750	216	CP17A_HUMAN	252-323	72	1	A:205-276	72
1.5	ENST00000369887	5	ENSE00000987441	chr10:104592437-104592268	170	CP17A_HUMAN	324-380	57	1	A:277-333	57
1.6b	ENST00000369887	6b	ENSE00000987442	chr10:104591368-104591265	104	CP17A_HUMAN	380-415	36	1	A:333-368	36
1.7c	ENST00000369887	7c	ENSE00001451179	chr10:104590742-104590288	455	CP17A_HUMAN	415-508	94	1	A:368-454	87

Theoretical Model

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:454
 aligned with CP17A_HUMAN | P05093 from UniProtKB/Swiss-Prot  Length:508

    Alignment length:454
                                    57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437       447       457       467       477       487       497    
          CP17A_HUMAN    48 HMHNNFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQMATLDIASNNRKGIAFADSGAHWQLHRRLAMATFALFKDGDQKLEKIICQEISTLCDMLATHNGQSIDISFPVFVAVTNVISLICFNTSYKNGDPELNVIQNYNEGIIDNLSKDSLVDLVPWLKIFPNKTLEKLKSHVKIRNDLLNKILENYKEKFRSDSITNMLDTLMQAKMNSDNGNAGPDQDSELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDQNVGFSRTPTISDRNRLLLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLNPAGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDDGQLPSLEGIPKVVFLIDSFKVKIKVRQAWRE 501
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhh.eeeeeee.eeeeeee.hhhhhhhhhh...eeeee.hhhhhhhhhhhh.........hhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhh...eeee..hhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhh......................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhh...eeeeeee.eeeee..eeeee.eeeeeeehhhhh...........................................hhhhhhhhhhhhhhhhhheeeee...........eeee.eeeee.eeeeeeee..... Sec.struct. author
             SAPs(SNPs) (1) ----------------S----------------------------C--Q---------P-------V-V----R----------------------------------------------------E--D-------------------------------------------------------------------------------------------------------------------------------------------------------D------------T----C----------Q---C----------L--------------------------------L----------C----------L-----------H-------------------------------------------------------C----- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ------------------------------------------------W----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------H-------------------------N--------------------------------R-----------------------------------------------------------------------------------------H----- SAPs(SNPs) (2)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------CYTOCHROME--------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a  PDB: A:1-52 UniProt: 1-99 [INCOMPLETE]   Exon 1.2b  PDB: A:53-99 UniProt: 100-146       ----------------------------------------------------------------------------Exon 1.3d  PDB: A:176-204    Exon 1.4a  PDB: A:205-276 UniProt: 252-323                              Exon 1.5  PDB: A:277-333 UniProt: 324-380                ----------------------------------Exon 1.7c  PDB: A:368-454 UniProt: 415-508 [INCOMPLETE]                                 Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------------------------------------------------------Exon 1.3a  PDB: A:99-175 UniProt: 146-222                                    -------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.6b  PDB: A:333-368           -------------------------------------------------------------------------------------- Transcript 1 (2)
                 2c17 A   1 HMHNNFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQMATLDIASNNRKGIAFADSGAHWQLHRRLAMATFALFKDGDQKLEKIICQEISTLCDMLATHNGQSIDISFPVFVAVTNVISLICFNTSYKNGDPELNVIQNYNEGIIDNLSKDSLVDLVPWLKIFPNKTLEKLKSHVKIRNDLLNKILENYKEKFRSDSITNMLDTLMQAKMNSDNGNAGPDQDSELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDQNVGFSRTPTISDRNRLLLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLNPAGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDDGQLPSLEGIPKVVFLIDSFKVKIKVRQAWRE 454
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 2C17)

(no "CATH Domain" information available for 2C17)

(no "Pfam Domain" information available for 2C17)

Theoretical Model(hide GO term definitions)

Chain A (CP17A_HUMAN | P05093)

molecular function
	GO:0047442	17-alpha-hydroxyprogesterone aldolase activity	Catalysis of the reaction: 17-alpha-hydroxyprogesterone = acetaldehyde + 4-androstene-3,17-dione.
	GO:0020037	heme binding	Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
	GO:0005506	iron ion binding	Interacting selectively and non-covalently with iron (Fe) ions.
	GO:0016829	lyase activity	Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0004497	monooxygenase activity	Catalysis of the incorporation of one atom from molecular oxygen into a compound and the reduction of the other atom of oxygen to water.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0016705	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	Catalysis of an oxidation-reduction (redox) reaction in which hydrogen or electrons are transferred from each of two donors, and molecular oxygen is reduced or incorporated into a donor.
	GO:0019825	oxygen binding	Interacting selectively and non-covalently with oxygen (O2).
	GO:0004508	steroid 17-alpha-monooxygenase activity	Catalysis of the reaction: a steroid + AH2 + O2 = a 17a-hydroxysteroid + A + H2O.
biological process
	GO:0033327	Leydig cell differentiation	The process in which a relatively unspecialized cell acquires specialized structural and/or functional features of a Leydig cell. A Leydig cell is a testosterone-secreting cell in the interstitial area, between the seminiferous tubules, in the testis.
	GO:0030325	adrenal gland development	The process whose specific outcome is the progression of the adrenal gland over time, from its formation to the mature structure. This gland can either be a discrete structure located bilaterally above each kidney, or a cluster of cells in the head kidney that perform the functions of the adrenal gland. In either case, this organ consists of two cells types, aminergic chromaffin cells and steroidogenic cortical cells.
	GO:0006702	androgen biosynthetic process	The chemical reactions and pathways resulting in the formation of androgens, C19 steroid hormones that can stimulate the development of male sexual characteristics.
	GO:0018879	biphenyl metabolic process	The chemical reactions and pathways involving biphenyl, a toxic aromatic hydrocarbon used as a heat transfer agent, as a fungistat in packaging citrus fruits and in plant disease control. Biphenyl can be chlorinated with 1-10 chlorine molecules to form polychlorinated biphenyls (PCBs).
	GO:0071236	cellular response to antibiotic	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an antibiotic stimulus. An antibiotic is a chemical substance produced by a microorganism which has the capacity to inhibit the growth of or to kill other microorganisms.
	GO:0071371	cellular response to gonadotropin stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a gonadotropin stimulus.
	GO:0071222	cellular response to lipopolysaccharide	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipopolysaccharide stimulus; lipopolysaccharide is a major component of the cell wall of gram-negative bacteria.
	GO:0018894	dibenzo-p-dioxin metabolic process	The chemical reactions and pathways involving dibenzo-p-dioxin, a substance composed of two benzene rings linked by two ether bonds. Dibenzo-p-dioxins are generated as by-products in the manufacturing of herbicides, insecticides, fungicides, paper pulp bleaching, and in incineration, and can accumulate in milk and throughout the food chain, creating significant health concern.
	GO:0006704	glucocorticoid biosynthetic process	The chemical reactions and pathways resulting in the formation of glucocorticoids, hormonal C21 corticosteroids synthesized from cholesterol.
	GO:0021766	hippocampus development	The progression of the hippocampus over time from its initial formation until its mature state.
	GO:0042446	hormone biosynthetic process	The chemical reactions and pathways resulting in the formation of any hormone, naturally occurring substances secreted by specialized cells that affects the metabolism or behavior of other cells possessing functional receptors for the hormone.
	GO:0008584	male gonad development	The process whose specific outcome is the progression of the male gonad over time, from its formation to the mature structure.
	GO:0006082	organic acid metabolic process	The chemical reactions and pathways involving organic acids, any acidic compound containing carbon in covalent linkage.
	GO:0030728	ovulation	The release of a mature ovum/oocyte from an ovary.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0018958	phenol-containing compound metabolic process	The chemical reactions and pathways involving a phenol, any compound containing one or more hydroxyl groups directly attached to an aromatic carbon ring.
	GO:0018963	phthalate metabolic process	The chemical reactions and pathways involving phthalate, the anion of phthalic acid. Phthalic acid diesters are used industrially in the production of a variety of household and consumer goods including plastic polymers, lubricating oils, and carriers for perfumes in cosmetics, while phthalic acid itself is used industrially as a plasticizer. Terephthalate is used in the synthesis of polyethylene terephthalate (polyethene terephthlate, abbreviated PET or PETE), a plastic polymer with many commercial uses.
	GO:0090031	positive regulation of steroid hormone biosynthetic process	Any process that increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of steroid hormones,compounds with a 1, 2, cyclopentanoperhydrophenanthrene nucleus that act as hormones.
	GO:0042448	progesterone metabolic process	The chemical reactions and pathways involving progesterone, a steroid hormone produced in the ovary which prepares and maintains the uterus for pregnancy. Also found in plants.
	GO:0010034	response to acetate	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an acetate stimulus.
	GO:0051591	response to cAMP	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cAMP (cyclic AMP, adenosine 3',5'-cyclophosphate) stimulus.
	GO:0034097	response to cytokine	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cytokine stimulus.
	GO:0042493	response to drug	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
	GO:0060992	response to fungicide	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a fungicide stimulus. Fungicides are chemicals used to kill fungi.
	GO:0034698	response to gonadotropin	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a gonadotropin stimulus.
	GO:0009635	response to herbicide	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a herbicide stimulus. Herbicides are chemicals used to kill or control the growth of plants.
	GO:0017085	response to insecticide	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an insecticide stimulus. Insecticides are chemicals used to kill insects.
	GO:0010212	response to ionizing radiation	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a ionizing radiation stimulus. Ionizing radiation is radiation with sufficient energy to remove electrons from atoms and may arise from spontaneous decay of unstable isotopes, resulting in alpha and beta particles and gamma rays. Ionizing radiation also includes X-rays.
	GO:0051597	response to methylmercury	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a methylmercury stimulus.
	GO:0031667	response to nutrient levels	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus reflecting the presence, absence, or concentration of nutrients.
	GO:0014070	response to organic cyclic compound	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic cyclic compound stimulus.
	GO:0010033	response to organic substance	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic substance stimulus.
	GO:0032526	response to retinoic acid	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a retinoic acid stimulus.
	GO:0048545	response to steroid hormone	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a steroid hormone stimulus.
	GO:0009636	response to toxic substance	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a toxic stimulus.
	GO:0007548	sex differentiation	The establishment of the sex of an organism by physical differentiation.
	GO:0006694	steroid biosynthetic process	The chemical reactions and pathways resulting in the formation of steroids, compounds with a 1,2,cyclopentanoperhydrophenanthrene nucleus; includes de novo formation and steroid interconversion by modification.
	GO:0008202	steroid metabolic process	The chemical reactions and pathways involving steroids, compounds with a 1,2,cyclopentanoperhydrophenanthrene nucleus.
	GO:0016125	sterol metabolic process	The chemical reactions and pathways involving sterols, steroids with one or more hydroxyl groups and a hydrocarbon side-chain in the molecule.
cellular component
	GO:0030424	axon	The long process of a neuron that conducts nerve impulses, usually away from the cell body to the terminals and varicosities, which are sites of storage and release of neurotransmitter.
	GO:0042995	cell projection	A prolongation or process extending from a cell, e.g. a flagellum or axon.
	GO:0005783	endoplasmic reticulum	The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
	GO:0005789	endoplasmic reticulum membrane	The lipid bilayer surrounding the endoplasmic reticulum.
	GO:0043231	intracellular membrane-bounded organelle	Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0043025	neuronal cell body	The portion of a neuron that includes the nucleus, but excludes cell projections such as axons and dendrites.

Theoretical Model
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		HEM	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
(no "Sites" information available for 2c17)

	Cis Peptide Bonds
		Ala A:83 - Thr A:84	[ RasMol ]
		Ile A:40 - Lys A:41	[ RasMol ]
		Lys A:94 - Leu A:95	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Theoretical Model PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2c17
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CP17A_HUMAN \| P05093
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	1.14.99.9
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	202110
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CP17A_HUMAN \| P05093
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	CP17A_HUMAN \| P05093	:	3ruk 3swz 4nkv 4nkw 4nkx 4nky 4nkz 5irq 5irv

(no "Related Entries Specified in the PDB File" available for 2C17)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 1)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (3, 3)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (25, 25)

PROSITE Motifs (1, 1)

Exons (8, 8)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (57, 57)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File