2BXR - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   HUMAN MONOAMINE OXIDASE A IN COMPLEX WITH CLORGYLINE, CRYSTAL FORM A

Authors :   L. De Colibus, C. Binda, D. E. Edmondson, A. Mattevi

Date :   27 Jul 05 (Deposition) - 09 Aug 05 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   3.00

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Neurotransmitter, Membrane-Protein, Flavin, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   L. De Colibus, M. Li, C. Binda, A. Lustig, D. E. Edmondson, A. Mattevi
Three-Dimensional Structure Of Human Monoamine Oxidase A (Mao A): Relation To The Structures Of Rat Mao A And Human Mao B
Proc. Natl. Acad. Sci. Usa V. 102 12864 2005
PubMed-ID: 16129825 | Reference-DOI: 10.1073/PNAS.0505975102

Molecule 1 - AMINE OXIDASE [FLAVIN-CONTAINING] A
	Chains	:	A, B
	EC Number	:	1.4.3.4
	Engineered	:	YES
	Expression System	:	PICHIA PASTORIS
	Expression System Taxid	:	4922
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	MONOAMINE OXIDASE TYPE A, MAO-A

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 4)

No.	Name	Count	Type	Full Name
1	FAD	2	Ligand/Ion	FLAVIN-ADENINE DINUCLEOTIDE
2	MLG	2	Ligand/Ion	N-[3-(2,4-DICHLOROPHENOXY)PROPYL]-N-METHYL-N-PROP-2-YNYLAMINE

Biological Unit 1 (2, 2)

No.	Name	Count	Type	Full Name
1	FAD	1	Ligand/Ion	FLAVIN-ADENINE DINUCLEOTIDE
2	MLG	1	Ligand/Ion	N-[3-(2,4-DICHLOROPHENOXY)PROPYL]-N-METHYL-N-PROP-2-YNYLAMINE

Biological Unit 2 (2, 2)

No.	Name	Count	Type	Full Name
1	FAD	1	Ligand/Ion	FLAVIN-ADENINE DINUCLEOTIDE
2	MLG	1	Ligand/Ion	N-[3-(2,4-DICHLOROPHENOXY)PROPYL]-N-METHYL-N-PROP-2-YNYLAMINE

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ILE A:19 , GLY A:20 , GLY A:22 , ILE A:23 , SER A:24 , LEU A:42 , GLU A:43 , ALA A:44 , ARG A:45 , GLY A:49 , GLY A:50 , ARG A:51 , THR A:52 , GLY A:66 , GLY A:67 , ALA A:68 , TYR A:69 , PRO A:243 , VAL A:244 , ALA A:272 , ILE A:273 , LEU A:277 , TRP A:397 , TYR A:402 , CYS A:406 , TYR A:407 , GLY A:434 , THR A:435 , GLY A:443 , TYR A:444 , MET A:445 , ALA A:448 , MLG A:601	BINDING SITE FOR RESIDUE FAD A 600
2	AC2	SOFTWARE	GLU A:216 , LEU A:337 , PHE A:352 , TYR A:407 , FAD A:600	BINDING SITE FOR RESIDUE MLG A 601
3	AC3	SOFTWARE	ILE B:19 , GLY B:20 , GLY B:22 , ILE B:23 , SER B:24 , LEU B:42 , GLU B:43 , ALA B:44 , ARG B:45 , GLY B:49 , GLY B:50 , ARG B:51 , THR B:52 , GLY B:66 , GLY B:67 , ALA B:68 , TYR B:69 , PRO B:243 , VAL B:244 , ALA B:272 , ILE B:273 , LEU B:277 , TRP B:397 , TYR B:402 , CYS B:406 , TYR B:407 , GLY B:434 , THR B:435 , GLY B:443 , TYR B:444 , MET B:445 , ALA B:448 , MLG B:601	BINDING SITE FOR RESIDUE FAD B 600
4	AC4	SOFTWARE	GLU B:216 , ILE B:335 , LEU B:337 , PHE B:352 , TYR B:407 , FAD B:600	BINDING SITE FOR RESIDUE MLG B 601

Asymmetric Unit

No.	Residues
1	A:321	-	A:323
2	B:321	-	B:323

Asymmetric Unit

No.	Residues
1	Arg A:284	-	Pro A:285
2	Cys A:406	-	Tyr A:407
3	Arg B:284	-	Pro B:285
4	Cys B:406	-	Tyr B:407

Asymmetric Unit (5, 10)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_036545	D	15	E	AOFA_HUMAN	Unclassified	---	A/B	D	15	E
2	CancerSNP	VAR_AOFA_HUMAN_CCDS14260_1_01 *	D	15	E	AOFA_HUMAN	Disease (Breast cancer)	---	A/B	D	15	E
3	UniProt	VAR_064573	E	188	K	AOFA_HUMAN	Polymorphism	77698881	A/B	E	188	K
4	UniProt	VAR_071963	C	266	F	AOFA_HUMAN	Disease	587777457	A/B	C	266	F
5	UniProt	VAR_014795	F	314	V	AOFA_HUMAN	Polymorphism	1799835	A/B	F	314	V
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (5, 5)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_036545	D	15	E	AOFA_HUMAN	Unclassified	---	A	D	15	E
2	CancerSNP	VAR_AOFA_HUMAN_CCDS14260_1_01 *	D	15	E	AOFA_HUMAN	Disease (Breast cancer)	---	A	D	15	E
3	UniProt	VAR_064573	E	188	K	AOFA_HUMAN	Polymorphism	77698881	A	E	188	K
4	UniProt	VAR_071963	C	266	F	AOFA_HUMAN	Disease	587777457	A	C	266	F
5	UniProt	VAR_014795	F	314	V	AOFA_HUMAN	Polymorphism	1799835	A	F	314	V
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (5, 5)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_036545	D	15	E	AOFA_HUMAN	Unclassified	---	B	D	15	E
2	CancerSNP	VAR_AOFA_HUMAN_CCDS14260_1_01 *	D	15	E	AOFA_HUMAN	Disease (Breast cancer)	---	B	D	15	E
3	UniProt	VAR_064573	E	188	K	AOFA_HUMAN	Polymorphism	77698881	B	E	188	K
4	UniProt	VAR_071963	C	266	F	AOFA_HUMAN	Disease	587777457	B	C	266	F
5	UniProt	VAR_014795	F	314	V	AOFA_HUMAN	Polymorphism	1799835	B	F	314	V
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 2BXR)

Asymmetric Unit (14, 28)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000338702	1a	ENSE00001415055	X:43515467-43515662	196	AOFA_HUMAN	1-25	25	2	A:12-25 B:12-25	14 14
1.3	ENST00000338702	3	ENSE00001416375	X:43542761-43542855	95	AOFA_HUMAN	25-56	32	2	A:25-56 B:25-56	32 32
1.4	ENST00000338702	4	ENSE00001409729	X:43552538-43552675	138	AOFA_HUMAN	57-102	46	2	A:57-102 B:57-102	46 46
1.5	ENST00000338702	5	ENSE00001405769	X:43571119-43571223	105	AOFA_HUMAN	103-137	35	2	A:103-137 (gaps) B:103-137 (gaps)	35 35
1.6	ENST00000338702	6	ENSE00001403714	X:43571952-43572043	92	AOFA_HUMAN	138-168	31	2	A:138-168 B:138-168	31 31
1.7	ENST00000338702	7	ENSE00001400730	X:43587420-43587561	142	AOFA_HUMAN	168-215	48	2	A:168-215 (gaps) B:168-215 (gaps)	48 48
1.8b	ENST00000338702	8b	ENSE00001383783	X:43590488-43590637	150	AOFA_HUMAN	216-265	50	2	A:216-265 B:216-265	50 50
1.9	ENST00000338702	9	ENSE00001382812	X:43590941-43591100	160	AOFA_HUMAN	266-319	54	2	A:266-319 B:266-319	54 54
1.10	ENST00000338702	10	ENSE00001377890	X:43591946-43592042	97	AOFA_HUMAN	319-351	33	2	A:319-351 B:319-351	33 33
1.11	ENST00000338702	11	ENSE00001373498	X:43595474-43595527	54	AOFA_HUMAN	351-369	19	2	A:351-369 B:351-369	19 19
1.12	ENST00000338702	12	ENSE00001369566	X:43599928-43599985	58	AOFA_HUMAN	369-388	20	2	A:369-388 B:369-388	20 20
1.13	ENST00000338702	13	ENSE00001677475	X:43601197-43601294	98	AOFA_HUMAN	389-421	33	2	A:389-421 B:389-421	33 33
1.14b	ENST00000338702	14b	ENSE00001614970	X:43603041-43603152	112	AOFA_HUMAN	421-458	38	2	A:421-458 B:421-458	38 38
1.15	ENST00000338702	15	ENSE00001378166	X:43603356-43603418	63	AOFA_HUMAN	459-479	21	2	A:459-464 B:459-464	6 6
1.16b	ENST00000338702	16b	ENSE00001389556	X:43603614-43606068	2455	AOFA_HUMAN	480-527	48	0	-	-

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:445
 aligned with AOFA_HUMAN | P21397 from UniProtKB/Swiss-Prot  Length:527

    Alignment length:453
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461   
           AOFA_HUMAN    12 HMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHVDYVDVGGAYVGPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIAYLDYNNLWRTIDNMGKEIPTDAPWEAQHADKWDKMTMKELIDKICWTKTARRFAYLFVNINVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSERIMDLLGDQVKLNHPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAKIHFRPELPAERNQLIQRLPMGAVIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIMGFILARKADRLAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYGRVIRQPVGRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLG 464
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2bxrA01                                2bxrA02              2bxrA01         2bxrA02                      2bxrA03 A:117-208 Guanine Nucleotide Dissociation Inhibitor, domain 1                       2b   xrA02 2bxrA01 A:12-50,A:72-87,A:220-300,A:409-464  [code=3.50.50.60, no name defined]  2bxrA02 A:51-71,A:88-116,A:209-219,A:301-408  [code=3.90.660.10, no name defined]                           2bxrA01 A:12-50,A:72-87,A:220-300,A:409-464              CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee..hhhhhhhhhhhhhh...eeee...........eeee...eeee.........hhhhhhhhhhh...eee.....eeeee....eee...-----.hhhhhhhhhhhhhhhhhhhhh....hhhhh.hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh.hhhhhhh..---...eee...hhhhhhhhhhhhh..ee....eeeee.....eeeee....eeeeeeeee..hhhhhh..eee...hhhhhhhhhhh....eeeeeee...hhhhhh.eeeeeee........eeee.........eeeeeeehhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh..eeeeee.................hhhhhhhhhh......eee.hhhhh.....hhhhhhhhhhhhhhhhhhh.. Sec.struct. author
             SAPs(SNPs) (1) ---E----------------------------------------------------------------------------------------------------------------------------------------------------------------------------K-----------------------------------------------------------------------------F-----------------------------------------------V------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---E----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a     -------------------------------Exon 1.4  PDB: A:57-102 UniProt: 57-102       Exon 1.5  PDB: A:103-137 (gaps)    Exon 1.6  PDB: A:138-168       -----------------------------------------------Exon 1.8b  PDB: A:216-265 UniProt: 216-265        -----------------------------------------------------Exon 1.10  PDB: A:319-351        -----------------Exon 1.12           Exon 1.13  PDB: A:389-421        -------------------------------------1.15   Transcript 1 (1)
           Transcript 1 (2) -------------Exon 1.3  PDB: A:25-56          ---------------------------------------------------------------------------------------------------------------Exon 1.7  PDB: A:168-215 (gaps) UniProt: 168-215--------------------------------------------------Exon 1.9  PDB: A:266-319 UniProt: 266-319             -------------------------------Exon 1.11          ---------------------------------------------------Exon 1.14b  PDB: A:421-458            ------ Transcript 1 (2)
                 2bxr A  12 HMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHVDYVDVGGAYVGPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRG-----WNPIAYLDYNNLWRTIDNMGKEIPTDAPWEAQHADKWDKMTMKELIDKICWTKTARRFAYLFVNINVTSEPHEVSALWFLWYVKQCGGTTRIFSV---GQERKFVGGSGQVSERIMDLLGDQVKLNHPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAKIHFRPELPAERNQLIQRLPMGAVIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIMGFILARKADRLAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYGRVIRQPVGRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLG 464
                                    21        31        41        51        61        71        81        91       101        |-    |  121       131       141       151       161       171       181       191       201        |-  |    221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461   
                                                                                                                            110   116                                                                                           210 214

Chain B from PDB  Type:PROTEIN  Length:445
 aligned with AOFA_HUMAN | P21397 from UniProtKB/Swiss-Prot  Length:527

    Alignment length:453
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461   
           AOFA_HUMAN    12 HMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHVDYVDVGGAYVGPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIAYLDYNNLWRTIDNMGKEIPTDAPWEAQHADKWDKMTMKELIDKICWTKTARRFAYLFVNINVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSERIMDLLGDQVKLNHPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAKIHFRPELPAERNQLIQRLPMGAVIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIMGFILARKADRLAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYGRVIRQPVGRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLG 464
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2bxrB01                                2bxrB02              2bxrB01         2bxrB02                      2bxrB03 B:117-208 Guanine Nucleotide Dissociation Inhibitor, domain 1                       2b   xrB02 2bxrB01 B:12-50,B:72-87,B:220-300,B:409-464  [code=3.50.50.60, no name defined]  2bxrB02 B:51-71,B:88-116,B:209-219,B:301-408  [code=3.90.660.10, no name defined]                           2bxrB01 B:12-50,B:72-87,B:220-300,B:409-464              CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee..hhhhhhhhhhhhhh...eeee...........eeee...eeee.........hhhhhhhhhhh...eee.....eeeee....eee...-----.hhhhhhhhhhhhhhhhhhhhh....hhhhh.hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh.hhhhhhh..---...eee...hhhhhhhhhhhhh..ee....eeeee.....eeeee....eeeeeeeee..hhhhhh..eee...hhhhhhhhhhh....eeeeeee...hhhhhh.eeeeeee........eeee.........eeeeeeehhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh..eeeeee.................hhhhhhhhhh......eee.hhhhh.....hhhhhhhhhhhhhhhhhhh.. Sec.struct. author
             SAPs(SNPs) (1) ---E----------------------------------------------------------------------------------------------------------------------------------------------------------------------------K-----------------------------------------------------------------------------F-----------------------------------------------V------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---E----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a     -------------------------------Exon 1.4  PDB: B:57-102 UniProt: 57-102       Exon 1.5  PDB: B:103-137 (gaps)    Exon 1.6  PDB: B:138-168       -----------------------------------------------Exon 1.8b  PDB: B:216-265 UniProt: 216-265        -----------------------------------------------------Exon 1.10  PDB: B:319-351        -----------------Exon 1.12           Exon 1.13  PDB: B:389-421        -------------------------------------1.15   Transcript 1 (1)
           Transcript 1 (2) -------------Exon 1.3  PDB: B:25-56          ---------------------------------------------------------------------------------------------------------------Exon 1.7  PDB: B:168-215 (gaps) UniProt: 168-215--------------------------------------------------Exon 1.9  PDB: B:266-319 UniProt: 266-319             -------------------------------Exon 1.11          ---------------------------------------------------Exon 1.14b  PDB: B:421-458            ------ Transcript 1 (2)
                 2bxr B  12 HMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHVDYVDVGGAYVGPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRG-----WNPIAYLDYNNLWRTIDNMGKEIPTDAPWEAQHADKWDKMTMKELIDKICWTKTARRFAYLFVNINVTSEPHEVSALWFLWYVKQCGGTTRIFSV---GQERKFVGGSGQVSERIMDLLGDQVKLNHPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAKIHFRPELPAERNQLIQRLPMGAVIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIMGFILARKADRLAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYGRVIRQPVGRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLG 464
                                    21        31        41        51        61        71        81        91       101        |-    |  121       131       141       151       161       171       181       191       201        |-  |    221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461   
                                                                                                                            110   116                                                                                           210 214

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 2BXR)

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(bba) Sandwich (528)

Topology: FAD/NAD(P)-binding domain (373)

Homologous Superfamily: [code=3.50.50.60, no name defined] (373)

Human (Homo sapiens) (57)

1a	2bxrA01	A:12-50,A:72-87,A:220-300,A:409-464
1b	2bxrB01	B:12-50,B:72-87,B:220-300,B:409-464

Architecture: Alpha-Beta Complex (3881)

Topology: Polyamine Oxidase; Chain A, domain 2 (62)

Homologous Superfamily: [code=3.90.660.10, no name defined] (61)

Human (Homo sapiens) (29)

2a	2bxrA02	A:51-71,A:88-116,A:209-219,A:301-408
2b	2bxrB02	B:51-71,B:88-116,B:209-219,B:301-408

Class: Mainly Alpha (13335)

Architecture: Orthogonal Bundle (10391)

Topology: Guanine Nucleotide Dissociation Inhibitor; domain 1 (50)

Homologous Superfamily: Guanine Nucleotide Dissociation Inhibitor, domain 1 (50)

Human (Homo sapiens) (29)

3a	2bxrA03	A:117-208
3b	2bxrB03	B:117-208

(no "Pfam Domain" information available for 2BXR)

Asymmetric Unit(hide GO term definitions)

Chain A,B (AOFA_HUMAN | P21397)

molecular function
	GO:0050660	flavin adenine dinucleotide binding	Interacting selectively and non-covalently with FAD, flavin-adenine dinucleotide, the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes, in either the oxidized form, FAD, or the reduced form, FADH2.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0008131	primary amine oxidase activity	Catalysis of the reaction: a primary amine + H2O + O2 = an aldehyde + NH3 + hydrogen peroxide.
	GO:0051378	serotonin binding	Interacting selectively and non-covalently with serotonin (5-hydroxytryptamine), a monoamine neurotransmitter occurring in the peripheral and central nervous systems, also having hormonal properties.
biological process
	GO:0006584	catecholamine metabolic process	The chemical reactions and pathways involving any of a group of physiologically important biogenic amines that possess a catechol (3,4-dihydroxyphenyl) nucleus and are derivatives of 3,4-dihydroxyphenylethylamine.
	GO:0006576	cellular biogenic amine metabolic process	The chemical reactions and pathways occurring at the level of individual cells involving any of a group of naturally occurring, biologically active amines, such as norepinephrine, histamine, and serotonin, many of which act as neurotransmitters.
	GO:0042420	dopamine catabolic process	The chemical reactions and pathways resulting in the breakdown of dopamine, a catecholamine neurotransmitter and a metabolic precursor of noradrenaline and adrenaline.
	GO:0042135	neurotransmitter catabolic process	The chemical reactions and pathways resulting in the breakdown of any of a group of substances that are released on excitation from the axon terminal of a presynaptic neuron of the central or peripheral nervous system and travel across the synaptic cleft to either excite or inhibit the target cell.
	GO:0042133	neurotransmitter metabolic process	The chemical reactions and pathways involving neurotransmitters, any of a group of substances that are released on excitation from the axon terminal of a presynaptic neuron of the central or peripheral nervous system and travel across the synaptic cleft to either excite or inhibit the target cell.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0042443	phenylethylamine metabolic process	The chemical reactions and pathways involving phenylethylamine, an amine with pharmacological properties similar to those of amphetamine, occurs naturally as a neurotransmitter in the brain, and is present in chocolate and oil of bitter almonds.
	GO:0042428	serotonin metabolic process	The chemical reactions and pathways involving serotonin (5-hydroxytryptamine), a monoamine neurotransmitter occurring in the peripheral and central nervous systems, also having hormonal properties.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005741	mitochondrial outer membrane	The outer, i.e. cytoplasm-facing, lipid bilayer of the mitochondrial envelope.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		FAD	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MLG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Arg A:284 - Pro A:285	[ RasMol ]
		Arg B:284 - Pro B:285	[ RasMol ]
		Cys A:406 - Tyr A:407	[ RasMol ]
		Cys B:406 - Tyr B:407	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2bxr
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	AOFA_HUMAN \| P21397
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	1.4.3.4
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	AOFA_HUMAN \| P21397
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	AOFA_HUMAN \| P21397	:	1h8q 2bxs 2z5x 2z5y

1h8q	HUMAN MONOAMINE OXIDASE TYPE A (TRUNCATED)
2bxs	HUMAN MONOAMINE OXIDASE A IN COMPLEX WITH CLORGYLINE, CRYSTAL FORMA B

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 4)

Sites (4, 4)

SS Bonds (2, 2)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (5, 10)

PROSITE Motifs (0, 0)

Exons (14, 28)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (3, 6)

Pfam Domains (0, 0)

Gene Ontology (16, 16)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File