1H8Q - JenaLib

Theoretical Model (14, 14)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000338702	1a	ENSE00001415055	X:43515467-43515662	196	AOFA_HUMAN	1-25	25	1	A:14-25	12
1.3	ENST00000338702	3	ENSE00001416375	X:43542761-43542855	95	AOFA_HUMAN	25-56	32	1	A:25-56	32
1.4	ENST00000338702	4	ENSE00001409729	X:43552538-43552675	138	AOFA_HUMAN	57-102	46	1	A:57-102	46
1.5	ENST00000338702	5	ENSE00001405769	X:43571119-43571223	105	AOFA_HUMAN	103-137	35	1	A:103-137	35
1.6	ENST00000338702	6	ENSE00001403714	X:43571952-43572043	92	AOFA_HUMAN	138-168	31	1	A:138-168	31
1.7	ENST00000338702	7	ENSE00001400730	X:43587420-43587561	142	AOFA_HUMAN	168-215	48	1	A:168-215	48
1.8b	ENST00000338702	8b	ENSE00001383783	X:43590488-43590637	150	AOFA_HUMAN	216-265	50	1	A:216-265	50
1.9	ENST00000338702	9	ENSE00001382812	X:43590941-43591100	160	AOFA_HUMAN	266-319	54	1	A:266-319	54
1.10	ENST00000338702	10	ENSE00001377890	X:43591946-43592042	97	AOFA_HUMAN	319-351	33	1	A:319-351	33
1.11	ENST00000338702	11	ENSE00001373498	X:43595474-43595527	54	AOFA_HUMAN	351-369	19	1	A:351-369	19
1.12	ENST00000338702	12	ENSE00001369566	X:43599928-43599985	58	AOFA_HUMAN	369-388	20	1	A:369-388	20
1.13	ENST00000338702	13	ENSE00001677475	X:43601197-43601294	98	AOFA_HUMAN	389-421	33	1	A:389-421	33
1.14b	ENST00000338702	14b	ENSE00001614970	X:43603041-43603152	112	AOFA_HUMAN	421-458	38	1	A:421-458	38
1.15	ENST00000338702	15	ENSE00001378166	X:43603356-43603418	63	AOFA_HUMAN	459-479	21	1	A:459-468	10
1.16b	ENST00000338702	16b	ENSE00001389556	X:43603614-43606068	2455	AOFA_HUMAN	480-527	48	0	-	-

Sequences/Alignments

Theoretical Model

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:455
 aligned with AOFA_HUMAN | P21397 from UniProtKB/Swiss-Prot  Length:527

    Alignment length:455
                                    23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463     
           AOFA_HUMAN    14 FDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHVDYVDVGGAYVGPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIAYLDYNNLWRTIDNMGKEIPTDAPWEAQHADKWDKMTMKELIDKICWTKTARRFAYLFVNINVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSERIMDLLGDQVKLNHPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAKIHFRPELPAERNQLIQRLPMGAVIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIMGFILARKADRLAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYGRVIRQPVGRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLGKVTE 468
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee..hhhhhhhhhhhhhhh..eeeee...........eee...eee.....eeeee.......hhhhhhh.....eee....hhhh.ee........hhhhhhhhhhhhhhhhh................hhhhhhhhhh.......hhhhhhhhhhhh..................hhhhhh...eeeee....hhhhhhhhhhhh.............eee...eeeee.....eeeee....eeee.eeee..hhhhhh..ee....hhhhhhhhhhh.ee.eeeeeee.............eeee........eeee.........eeeeeeehhhhhhhhhhhhhhhhhhhhhhhhhhh.........eee.............ee.......hhhhhhhhhh....eee...........hhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
             SAPs(SNPs) (1) -E----------------------------------------------------------------------------------------------------------------------------------------------------------------------------K-----------------------------------------------------------------------------F-----------------------------------------------V---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -E--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a   -------------------------------Exon 1.4  PDB: A:57-102 UniProt: 57-102       Exon 1.5  PDB: A:103-137           Exon 1.6  PDB: A:138-168       -----------------------------------------------Exon 1.8b  PDB: A:216-265 UniProt: 216-265        -----------------------------------------------------Exon 1.10  PDB: A:319-351        -----------------Exon 1.12           Exon 1.13  PDB: A:389-421        -------------------------------------Exon 1.15  Transcript 1 (1)
           Transcript 1 (2) -----------Exon 1.3  PDB: A:25-56          ---------------------------------------------------------------------------------------------------------------Exon 1.7  PDB: A:168-215 UniProt: 168-215       --------------------------------------------------Exon 1.9  PDB: A:266-319 UniProt: 266-319             -------------------------------Exon 1.11          ---------------------------------------------------Exon 1.14b  PDB: A:421-458            ---------- Transcript 1 (2)
                 1h8q A  14 FDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHVDYVDVGGAYVGPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIAYLDYNNLWRTIDNMGKEIPTDAPWEAQHADKWDKMTMKELIDKICWTKTARRFAYLFVNINVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSERIMDLLGDQVKLNHPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAKIHFRPELPAERNQLIQRLPMGAVIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIMGFILARKADRLAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYGRVIRQPVGRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLGKVTE 468
                                    23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (16, 16)

Theoretical Model(hide GO term definitions)

Chain A (AOFA_HUMAN | P21397)

molecular function
	GO:0050660	flavin adenine dinucleotide binding	Interacting selectively and non-covalently with FAD, flavin-adenine dinucleotide, the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes, in either the oxidized form, FAD, or the reduced form, FADH2.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0008131	primary amine oxidase activity	Catalysis of the reaction: a primary amine + H2O + O2 = an aldehyde + NH3 + hydrogen peroxide.
	GO:0051378	serotonin binding	Interacting selectively and non-covalently with serotonin (5-hydroxytryptamine), a monoamine neurotransmitter occurring in the peripheral and central nervous systems, also having hormonal properties.
biological process
	GO:0006584	catecholamine metabolic process	The chemical reactions and pathways involving any of a group of physiologically important biogenic amines that possess a catechol (3,4-dihydroxyphenyl) nucleus and are derivatives of 3,4-dihydroxyphenylethylamine.
	GO:0006576	cellular biogenic amine metabolic process	The chemical reactions and pathways occurring at the level of individual cells involving any of a group of naturally occurring, biologically active amines, such as norepinephrine, histamine, and serotonin, many of which act as neurotransmitters.
	GO:0042420	dopamine catabolic process	The chemical reactions and pathways resulting in the breakdown of dopamine, a catecholamine neurotransmitter and a metabolic precursor of noradrenaline and adrenaline.
	GO:0042135	neurotransmitter catabolic process	The chemical reactions and pathways resulting in the breakdown of any of a group of substances that are released on excitation from the axon terminal of a presynaptic neuron of the central or peripheral nervous system and travel across the synaptic cleft to either excite or inhibit the target cell.
	GO:0042133	neurotransmitter metabolic process	The chemical reactions and pathways involving neurotransmitters, any of a group of substances that are released on excitation from the axon terminal of a presynaptic neuron of the central or peripheral nervous system and travel across the synaptic cleft to either excite or inhibit the target cell.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0042443	phenylethylamine metabolic process	The chemical reactions and pathways involving phenylethylamine, an amine with pharmacological properties similar to those of amphetamine, occurs naturally as a neurotransmitter in the brain, and is present in chocolate and oil of bitter almonds.
	GO:0042428	serotonin metabolic process	The chemical reactions and pathways involving serotonin (5-hydroxytryptamine), a monoamine neurotransmitter occurring in the peripheral and central nervous systems, also having hormonal properties.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005741	mitochondrial outer membrane	The outer, i.e. cytoplasm-facing, lipid bilayer of the mitochondrial envelope.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1h8q
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	AOFA_HUMAN \| P21397
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	1.4.3.4
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 1)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (5, 5)

PROSITE Motifs (0, 0)

Exons (14, 14)