|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (4, 7)| Asymmetric Unit (4, 7) Biological Unit 1 (3, 18) |
Sites (3, 3)
Asymmetric Unit (3, 3)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2BS5) |
Cis Peptide Bonds (1, 1)
Asymmetric Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2BS5) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2BS5) |
Exons (0, 0)| (no "Exon" information available for 2BS5) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:90 aligned with D8NA05_RALSL | D8NA05 from UniProtKB/TrEMBL Length:91 Alignment length:90 11 21 31 41 51 61 71 81 91 D8NA05_RALSL 2 SSVQTAATSWGTVPSIRVYTANNGKITERCWDGKGWYTGAFNEPGDNVSVTSWLVGSAIHIRVYASTGTTTTEWCWDGNGWTKGAYTATN 91 SCOP domains ------------------------------------------------------------------------------------------ SCOP domains CATH domains ------------------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------ Transcript 2bs5 A 1 SSVQTAATSWGTVPSIRVYTANNGKITERCWDGKGWYTGAFNEPGDNVSVTSWLVGSAIHIRVYASTGTTTTEWCWDGNGWTKGAYTATN 90 10 20 30 40 50 60 70 80 90 Chain A from PDB Type:PROTEIN Length:90 aligned with Q8XXK6_RALSO | Q8XXK6 from UniProtKB/TrEMBL Length:91 Alignment length:90 11 21 31 41 51 61 71 81 91 Q8XXK6_RALSO 2 SSVQTAATSWGTVPSIRVYTANNGKITERCWDGKGWYTGAFNEPGDNVSVTSWLVGSAIHIRVYASSGTTTTEWCWDGNGWTKGAYTSTN 91 SCOP domains ------------------------------------------------------------------------------------------ SCOP domains CATH domains ------------------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------ Transcript 2bs5 A 1 SSVQTAATSWGTVPSIRVYTANNGKITERCWDGKGWYTGAFNEPGDNVSVTSWLVGSAIHIRVYASTGTTTTEWCWDGNGWTKGAYTATN 90 10 20 30 40 50 60 70 80 90
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2BS5) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2BS5) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2BS5) |
Gene Ontology (1, 2)|
Asymmetric Unit(hide GO term definitions) Chain A (D8NA05_RALSL | D8NA05)
Chain A (Q8XXK6_RALSO | Q8XXK6)
|
||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|