Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF MONOMERIC RALSTONIA SOLANACEARUM LECTIN
 
Authors :  J. Arnaud, K. Trundle, J. Claudinon, A. Audfray, A. Varrot, W. Romer, A.
Date :  06 Mar 14  (Deposition) - 08 Oct 14  (Release) - 15 Oct 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.35
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Fucose-Binding Protein, Beta Propeller (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. Arnaud, K. Trondle, J. Claudinon, A. Audfray, A. Varrot, W. Romer, A. Imberty
Membrane Deformation By Neolectins With Engineered Glycolipid Binding Sites.
Angew. Chem. Int. Ed. Engl. V. 53 9267 2014
PubMed-ID: 25044646  |  Reference-DOI: 10.1002/ANIE.201404568

(-) Compounds

Molecule 1 - FUCOSE-BINDING LECTIN PROTEIN
    Atcc: 11696
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET-TEV
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Variant: TUNER
    Expression System Vector Type: PLASMID
    Organism Scientific: RALSTONIA SOLANACEARUM
    Organism Taxid: 305
    Other Details: MONOMERIC CHIMERA OF THE WILD TYPE RSL
    Synonym: LECTIN FROM RALSTONIA SOLANACEARUM

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 13)

Asymmetric Unit (2, 13)
No.NameCountTypeFull Name
1GOL1Ligand/IonGLYCEROL
2MFU12Ligand/IonALPHA-L-METHYL-FUCOSE
Biological Unit 1 (2, 7)
No.NameCountTypeFull Name
1GOL1Ligand/IonGLYCEROL
2MFU6Ligand/IonALPHA-L-METHYL-FUCOSE
Biological Unit 2 (1, 6)
No.NameCountTypeFull Name
1GOL-1Ligand/IonGLYCEROL
2MFU6Ligand/IonALPHA-L-METHYL-FUCOSE

(-) Sites  (13, 13)

Asymmetric Unit (13, 13)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREARG A:108 , GLU A:119 , TYR A:128 , GLY A:130 , ALA A:131 , PHE A:132 , TRP A:167 , TRP A:172BINDING SITE FOR RESIDUE MFU A 301
02AC2SOFTWAREARG A:153 , GLU A:164 , GLY A:175 , ALA A:176 , TYR A:177 , TRP A:213 , TRP A:218 , HOH A:2331 , HOH A:2332 , ALA B:131BINDING SITE FOR RESIDUE MFU A 302
03AC3SOFTWAREARG A:199 , GLU A:210 , TYR A:219 , GLY A:221 , ALA A:222 , PHE A:223 , TRP A:258 , TRP A:263 , HOH A:2333 , HOH A:2334BINDING SITE FOR RESIDUE MFU A 303
04AC4SOFTWAREILE A:16 , TRP A:31 , TRP A:36 , ARG A:244 , GLU A:255 , GLY A:266 , ALA A:267 , TYR A:268 , HOH A:2335 , HOH A:2336BINDING SITE FOR RESIDUE MFU A 304
05AC5SOFTWAREARG A:17 , GLU A:28 , GLY A:39 , ALA A:40 , PHE A:41 , TRP A:76 , TRP A:81 , LYS B:265 , HOH B:2314BINDING SITE FOR RESIDUE MFU A 305
06AC6SOFTWAREARG A:62 , GLU A:73 , GLY A:84 , ALA A:85 , TYR A:86 , ILE A:107 , TRP A:122 , TRP A:127 , HOH A:2337 , HOH A:2338BINDING SITE FOR RESIDUE MFU A 306
07AC7SOFTWARETHR A:8 , VAL A:50 , THR A:51 , ALA A:98 , THR A:99 , SER A:100 , HOH A:2013 , HOH A:2014BINDING SITE FOR RESIDUE GOL A 307
08AC8SOFTWAREARG B:17 , GLU B:28 , TYR B:37 , GLY B:39 , ALA B:40 , PHE B:41 , TRP B:76 , TRP B:81 , HOH B:2306 , HOH B:2307BINDING SITE FOR RESIDUE MFU B 301
09AC9SOFTWAREARG B:62 , GLU B:73 , GLY B:84 , ALA B:85 , TYR B:86 , ILE B:107 , TRP B:122 , TRP B:127 , HOH B:2308 , HOH B:2309BINDING SITE FOR RESIDUE MFU B 302
10BC1SOFTWARELYS A:174 , HOH A:2331 , HOH A:2332 , ARG B:108 , GLU B:119 , GLY B:130 , ALA B:131 , PHE B:132 , TRP B:167 , TRP B:172BINDING SITE FOR RESIDUE MFU B 303
11BC2SOFTWAREARG B:153 , GLU B:164 , GLY B:175 , ALA B:176 , TYR B:177 , ILE B:198 , TRP B:213 , TRP B:218 , HOH B:2310 , HOH B:2311BINDING SITE FOR RESIDUE MFU B 304
12BC3SOFTWAREARG B:199 , GLU B:210 , TYR B:219 , GLY B:221 , ALA B:222 , PHE B:223 , TRP B:258 , TRP B:263BINDING SITE FOR RESIDUE MFU B 305
13BC4SOFTWAREALA A:40 , TRP B:31 , TRP B:36 , ARG B:244 , GLU B:255 , GLY B:266 , ALA B:267 , TYR B:268 , HOH B:2313 , HOH B:2314BINDING SITE FOR RESIDUE MFU B 306

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4CSD)

(-) Cis Peptide Bonds  (6, 6)

Asymmetric Unit
No.Residues
1Val A:13 -Pro A:14
2Val A:104 -Pro A:105
3Val A:195 -Pro A:196
4Val B:13 -Pro B:14
5Val B:104 -Pro B:105
6Val B:195 -Pro B:196

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4CSD)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4CSD)

(-) Exons   (0, 0)

(no "Exon" information available for 4CSD)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:266
 aligned with Q8XXK6_RALSO | Q8XXK6 from UniProtKB/TrEMBL  Length:91

    Alignment length:266
                                                                                                                          91                                                                                                                                                                          
                                                                                                                   89    90|                                                                                                                                                                          
                                    10        20        30        40        50        60        70        80        |-    ||   -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -      
         Q8XXK6_RALSO     1 MSSVQTAATSWGTVPSIRVYTANNGKITERCWDGKGWYTGAFNEPGDNVSVTSWLVGSAIHIRVYASSGTTTTEWCWDGNGWTKGAYTS-----TN--------------------------------------------------------------------------------------------------------------------------------------------------------------------------   -
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeee....eeeeeeee..eeeeeee....eeeeeeeee..eeeeeeeee..eeeeeeeeee..eeeeeee....eeeeeeee.eeeeeee....eeeeeeee..eeeeeee....eeeeeeeee..eeeeeeeee..eeeeeeeeee.eeeeeee....eeeeeeee......eeeeeee....eeeeeeee..eeeeeee....eeeeeeeee..eeeeeeeee..eeeeeeeeee..eeeeeee....eee...... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4csd A   0 MSSVQTAATSWGTVPSIRVYTANNGKITERCWDGKGWYTGAFNEPGDNVSVTSWLVGSAIHIRVYASTGTTTTEWCWDGNGWTKGAYTSDQTAATSWGTVPSIRVYTANNGKITERCWDGKGWYTGAFNEPGDNVSVTSWLVGSAIHIRVYASTGTTTEWCWDGNGWTKGAYTSSTVPGDQTAATSWGTVPSIRVYTANNGKITERCWDGKGWYTGAFNEPGDNVSVTSWLVGSAIHIRVYASTGTTTTEWCWDGNGWTKGAYTAT 271
                                     9        19        29        39        49        59        69        79        94       104       114       124       134       144       154    || 165       175       185       195       205       215       225       235       245       255       265      
                                                                                                                   88|                                                              159|                                                                                                              
                                                                                                                    94                                                               161                                                                                                              


Chain B from PDB  Type:PROTEIN  Length:267
 aligned with Q8XXK6_RALSO | Q8XXK6 from UniProtKB/TrEMBL  Length:91

    Alignment length:267
                                                                                                                           91                                                                                                                                                                          
                                                                                                                  89      90|                                                                                                                                                                          
                                    11        21        31        41        51        61        71        81       | -     ||  -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -       
         Q8XXK6_RALSO     2 SSVQTAATSWGTVPSIRVYTANNGKITERCWDGKGWYTGAFNEPGDNVSVTSWLVGSAIHIRVYASSGTTTTEWCWDGNGWTKGAYTS-------TN--------------------------------------------------------------------------------------------------------------------------------------------------------------------------   -
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeee....eeeeeeee..eeeeeee....eeeeeeeee..eeeeeeeee..eeeeeeeeee..eeeeeee....eeeeeeee...eeeeeee....eeeeeeee..eeeeeee....eeeeeeeee..eeeeeeeee..eeeeeeeeee..eeeeeee....eeeeeeee......eeeeeee....eeeeeeee..eeeeeee....eeeeeeeee..eeeeeeeee..eeeeeeeeee..eeeeeee....eee..... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4csd B   1 SSVQTAATSWGTVPSIRVYTANNGKITERCWDGKGWYTGAFNEPGDNVSVTSWLVGSAIHIRVYASTGTTTTEWCWDGNGWTKGAYTSPGDQTAATSWGTVPSIRVYTANNGKITERCWDGKGWYTGAFNEPGDNVSVTSWLVGSAIHIRVYASTGTTTTEWCWDGNGWTKGAYTSSTVPGDQTAATSWGTVPSIRVYTANNGKITERCWDGKGWYTGAFNEPGDNVSVTSWLVGSAIHIRVYASTGTTTTEWCWDGNGWTKGAYTA 270
                                    10        20        30        40        50        60        70        80       |93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       
                                                                                                                  88|                                                                                                                                                                                  
                                                                                                                   92
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4CSD)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4CSD)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4CSD)

(-) Gene Ontology  (1, 1)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (Q8XXK6_RALSO | Q8XXK6)
molecular function
    GO:0030246    carbohydrate binding    Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MFU  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Val A:104 - Pro A:105   [ RasMol ]  
    Val A:13 - Pro A:14   [ RasMol ]  
    Val A:195 - Pro A:196   [ RasMol ]  
    Val B:104 - Pro B:105   [ RasMol ]  
    Val B:13 - Pro B:14   [ RasMol ]  
    Val B:195 - Pro B:196   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4csd
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8XXK6_RALSO | Q8XXK6
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q8XXK6_RALSO | Q8XXK6
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q8XXK6_RALSO | Q8XXK6: 2bs5 2bs6 2bt9

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4CSD)