2ARJ - JenaLib

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CD8ALPHA-ALPHA IN COMPLEX WITH YTS 105.18 FAB

Authors :   D. A. Shore, L. Teyton, R. A. Dwek, P. M. Rudd, I. A. Wilson

Date :   19 Aug 05 (Deposition) - 30 May 06 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.88

Chains :   Asym. Unit : A,B,H,L,Q,R
Biol. Unit 1: H,L,Q  (1x)
Biol. Unit 2: A,B,R  (1x)

Keywords :   Protein-Protein Complex, Antibody Fab, Immune System, Immunoglobulin Domain (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   D. A. Shore, L. Teyton, R. A. Dwek, P. M. Rudd, I. A. Wilson
Crystal Structure Of The Tcr Co-Receptor Cd8Alphaalpha In Complex With Monoclonal Antibody Yts 105. 18 Fab Fragment At 2. 88 A Resolution.
J. Mol. Biol. V. 358 347 2006
PubMed-ID: 16530222 | Reference-DOI: 10.1016/J.JMB.2006.02.016

Molecule 1 - YTS 105.18 ANTIGEN BINDING REGION LIGHT CHAIN
	Cell Line	:	HYBRIDOMA
	Chains	:	L, A
	Fragment	:	YTS 105.18 FAB LIGHT CHAIN
	Organism Common	:	NORWAY RAT
	Organism Scientific	:	RATTUS NORVEGICUS
	Organism Taxid	:	10116
	Strain	:	Y3 MYELOMA

Molecule 2 - YTS 105.18 ANTIGEN BINDING REGION HEAVY CHAIN
	Cell Line	:	HYBRIDOMA
	Chains	:	H, B
	Fragment	:	YTS 105.18 FAB HEAVY CHAIN
	Organism Common	:	NORWAY RAT
	Organism Scientific	:	RATTUS NORVEGICUS
	Organism Taxid	:	10116
	Strain	:	Y3 MYELOMA

Molecule 3 - T-CELL SURFACE GLYCOPROTEIN CD8 ALPHA CHAIN
	Chains	:	R, Q
	Engineered	:	YES
	Expression System	:	DROSOPHILA MELANOGASTER
	Expression System Common	:	FRUIT FLY
	Expression System Plasmid	:	PMT
	Expression System Strain	:	SC2 CELLS
	Expression System Taxid	:	7227
	Expression System Vector Type	:	PLASMID
	Fragment	:	CD8ALPHA-ALPHA
	Gene	:	CD8A, LYT-2, LYT2
	Organism Common	:	HOUSE MOUSE
	Organism Scientific	:	MUS MUSCULUS
	Organism Taxid	:	10090
	Synonym	:	T-CELL SURFACE GLYCOPROTEIN LYT-2

		1	2	3	4	5	6
Asymmetric Unit	:	A	B	H	L	Q	R
Biological Unit 1 (1x)	:			H	L	Q
Biological Unit 2 (1x)	:	A	B				R

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2ARJ)

(no "Site" information available for 2ARJ)

Asymmetric Unit

No.	Residues
1	A:23	-	A:88
2	A:134	-	A:194
3	B:22	-	B:92
4	B:142	-	B:205
5	H:22	-	H:92
6	H:142	-	H:205
7	L:23	-	L:88
8	L:134	-	L:194
9	Q:26	-	Q:102
10	R:26	-	R:102

Asymmetric Unit

No.	Residues
1	Ser L:7	-	Pro L:8
2	Ser L:94	-	Pro L:95
3	Tyr L:140	-	Pro L:141
4	Phe H:148	-	Pro H:149
5	Glu H:150	-	Pro H:151
6	Ser A:7	-	Pro A:8
7	Ser A:94	-	Pro A:95
8	Tyr A:140	-	Pro A:141
9	Phe B:148	-	Pro B:149
10	Phe R:10	-	Pro R:11
11	Phe Q:10	-	Pro Q:11

Asymmetric Unit (1, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_CD8A_MOUSE_001 *	M	105	V	CD8A_MOUSE	---	---	Q/R	M	78	V
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_CD8A_MOUSE_001 *	M	105	V	CD8A_MOUSE	---	---	Q	M	78	V
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_CD8A_MOUSE_001 *	M	105	V	CD8A_MOUSE	---	---	R	M	78	V
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	IG_MHC	PS00290	Immunoglobulins and major histocompatibility complex proteins signature.	KACA_RAT	84-90	2	A:192-198 L:192-198

Biological Unit 1 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	IG_MHC	PS00290	Immunoglobulins and major histocompatibility complex proteins signature.	KACA_RAT	84-90	1	- L:192-198

Biological Unit 2 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	IG_MHC	PS00290	Immunoglobulins and major histocompatibility complex proteins signature.	KACA_RAT	84-90	1	A:192-198 -

(no "Exon" information available for 2ARJ)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:211
 aligned with KACA_RAT | P01836 from UniProtKB/Swiss-Prot  Length:106

    Alignment length:211
                                                                                                                                        1                                                                                                      
                                     -         -         -         -         -         -         -         -         -         -        |2        12        22        32        42        52        62        72        82        92       102 
            KACA_RAT      - ------------------------------------------------------------------------------------------------------------ADAAPTVSIFPPSMEQLTSGGATVVCFVNNFYPRDISVKWKIDGSEQRDGVLDSVTDQDSKDSTYSMSSTLSLTKVEYERHNLYTCEVVHKTSSSPVVKSFNR  103
               SCOP domains d2arja1 A:1-107 Immunoglobulin light chain kappa variable domain, VL-kappa                                 d2arja2 A:108-211 Immunoglobulin light chain kappa constant domain, CL-kappa                             SCOP domains
               CATH domains 2arjA01 A:1-108 Immunoglobulins                                                                             2arjA02 A:109-211 Immunoglobulins                                                                       CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee..eeeee....eeeeeee.......eeeeee......eeeee...ee.......eeeeee..eeeeee...hhhhheeeeeee...........eeeeee......eeeee..hhhhhhh.eeeeeeeeeee.....eeeeee..eee...eeeee.........eeeeeeeeeehhhhh...eeeeeeee..eeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------IG_MHC ------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2arj A    1 DIVMTQSPSSLAVSAGERVTLNCKASQNVRNNIAWYQQKPGQSPKLLIYYASYRYTGVPDRFTGDGFGTDFTLAINSVQADDAAFYYCQRIYNSPYTFGAGTKLELIRADAAPTVSIFPPSMEQLTSGGASVVCFVNNFYPRDISVKWKIDGSEQRDGVLDSVTDQDSKDSTYSMSSTLSLTKVEYERHNLYTCEVVHKTSSSPVVKSFNR  211
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210

Chain B from PDB  Type:PROTEIN  Length:212
                                                                                                                                                                                                                                                     
               SCOP domains d2arjb1 B:1-113 Immunoglobulin heavy chain variable domain, VH                                                       d2arjb2 B:114-228 Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma                 SCOP domains
               CATH domains 2arjB01 B:1-113 Immunoglobulins                                                                                      2arjB02 B:114-227 Immunoglobulins                                                             - CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee...ee.....eeeeeeee.......eeeeeee......eeeeee.....eee...hhh.eeeeeehhh.eeeeee...hhhhheeeeeeee............eeeee........eeeee........eeeeeeeeee.....eeee.hhh.....ee...eee..eeeeeeeeee........eeeeeehhhheeeeee.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2arj B    1 QVQLKESGPGLVQPSQTLSLTCTVSGFSLTSNSVHWVRQPPGKGLEWMGGIWGDGDTDYNSALKSRLSISRDTSKNQVFLKMNSLQTDDTAIYFCTPLIGSWYFDFWGPGTMVTASSAQTTAPSVYPLAPGCGSSTVTLGCLVKGYFPEPVTVTWNSGALSSDVHTFPAVLQSGLYTLTSSVTSSTWPSQTVTCNVAHPASSTKVDQKIVPR  228
                                    10        20        30        40        50        60        70        80  |||   87        97   |   106       116       126  ||   141       151  |||| 166  ||   177||     189      |200|   || 214       226  
                                                                                                            82A||               100A                          129|                154|||    169|    178|            196| || 206|          223|  
                                                                                                             82B|                                              135                 156||     171     181             198 ||  210           226  
                                                                                                              82C                                                                   157|                               200|                     
                                                                                                                                                                                     162                                202

Chain H from PDB  Type:PROTEIN  Length:212
                                                                                                                                                                                                                                                     
               SCOP domains d2arjh1 H:1-113 Immunoglobulin heavy chain variable domain, VH                                                       d2arjh2 H:114-228 Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma                 SCOP domains
               CATH domains 2arjH01 H:1-113 Immunoglobulins                                                                                      2arjH02 H:114-227 Immunoglobulins                                                             - CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee...ee.....eeeeeeee.......eeeeeee......eeeeee.....eee...hhh.eeeeeehhh.eeeeee...hhhhheeeeeeee............eeeee........eeeee........eeeeeeeeee.....eeee.hhh.....ee...eee..eeeeeeeeee........eeeeeehhhheeeeee.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2arj H    1 QVQLKESGPGLVQPSQTLSLTCTVSGFSLTSNSVHWVRQPPGKGLEWMGGIWGDGDTDYNSALKSRLSISRDTSKNQVFLKMNSLQTDDTAIYFCTPLIGSWYFDFWGPGTMVTASSAQTTAPSVYPLAPGCGSSTVTLGCLVKGYFPEPVTVTWNSGALSSDVHTFPAVLQSGLYTLTSSVTSSTWPSQTVTCNVAHPASSTKVDQKIVPR  228
                                    10        20        30        40        50        60        70        80  |||   87        97   |   106       116       126  ||   141       151  |||| 166  ||   177||     189      |200|   || 214       226  
                                                                                                            82A||               100A                          129|                154|||    169|    178|            196| || 206|          223|  
                                                                                                             82B|                                              135                 156||     171     181             198 ||  210           226  
                                                                                                              82C                                                                   157|                               200|                     
                                                                                                                                                                                     162                                202

Chain L from PDB  Type:PROTEIN  Length:211
 aligned with KACA_RAT | P01836 from UniProtKB/Swiss-Prot  Length:106

    Alignment length:211
                                                                                                                                        1                                                                                                      
                                     -         -         -         -         -         -         -         -         -         -        |2        12        22        32        42        52        62        72        82        92       102 
            KACA_RAT      - ------------------------------------------------------------------------------------------------------------ADAAPTVSIFPPSMEQLTSGGATVVCFVNNFYPRDISVKWKIDGSEQRDGVLDSVTDQDSKDSTYSMSSTLSLTKVEYERHNLYTCEVVHKTSSSPVVKSFNR  103
               SCOP domains d2arjl1 L:1-107 Immunoglobulin light chain kappa variable domain, VL-kappa                                 d2arjl2 L:108-211 Immunoglobulin light chain kappa constant domain, CL-kappa                             SCOP domains
               CATH domains 2arjL01 L:1-108 Immunoglobulins                                                                             2arjL02 L:109-211 Immunoglobulins                                                                       CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee..eeeee....eeeeeee.......eeeeee......eeeee...ee.......eeeeee..eeeeee...hhhhheeeeeee...........eeeeee......eeeee..hhhhhhh.eeeeeeeeeee.....eeeeee..eee...eeeee.........eeeeeeeeeehhhhh...eeeeeeee..eeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------IG_MHC ------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2arj L    1 DIVMTQSPSSLAVSAGERVTLNCKASQNVRNNIAWYQQKPGQSPKLLIYYASYRYTGVPDRFTGDGFGTDFTLAINSVQADDAAFYYCQRIYNSPYTFGAGTKLELIRADAAPTVSIFPPSMEQLTSGGASVVCFVNNFYPRDISVKWKIDGSEQRDGVLDSVTDQDSKDSTYSMSSTLSLTKVEYERHNLYTCEVVHKTSSSPVVKSFNR  211
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210

Chain Q from PDB  Type:PROTEIN  Length:115
 aligned with CD8A_MOUSE | P01731 from UniProtKB/Swiss-Prot  Length:247

    Alignment length:119
                                    40        50        60        70        80        90       100       110       120       130       140         
          CD8A_MOUSE     31 APELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKV  149
               SCOP domains d2arjq_ Q: CD8                                                                                                          SCOP domains
               CATH domains 2arjQ00 Q:4-122 Immunoglobulins                                                                                         CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee...eee.....eeeeeee.......eeeeeee........eeeeee......eee...----..eeeee....eeeeee........eeeeeeeee..eeee...eeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------V-------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript
                2arj Q    4 APELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEK----KLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKV  122
                                    13        23        33        43        53        63    |   73        83        93       103       113         
                                                                                           68   73

Chain R from PDB  Type:PROTEIN  Length:116
 aligned with CD8A_MOUSE | P01731 from UniProtKB/Swiss-Prot  Length:247

    Alignment length:120
                                    40        50        60        70        80        90       100       110       120       130       140       150
          CD8A_MOUSE     31 APELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVN  150
               SCOP domains d2arjr_ R: CD8                                                                                                           SCOP domains
               CATH domains 2arjR00 R:4-123 Immunoglobulins                                                                                          CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeee...eee.....eeeeeee.......eeeeeee........eeeeee......eee...----..eeeee....eeeeee........eeeeeeeee..eeee...eeeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------V--------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------ Transcript
                2arj R    4 APELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEK----KLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVN  123
                                    13        23        33        43        53        63    |   73        83        93       103       113       123
                                                                                           68   73

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Sandwich (5577)

Topology: Immunoglobulin-like (3897)

Homologous Superfamily: Immunoglobulins (2282)

Norway rat (Rattus norvegicus) (32)

1a	2arjA02	A:109-211
1b	2arjL02	L:109-211
1c	2arjA01	A:1-108
1d	2arjL01	L:1-108
1e	2arjB02	B:114-227
1f	2arjH02	H:114-227
1g	2arjB01	B:1-113
1h	2arjH01	H:1-113
1i	2arjQ00	Q:4-122
1j	2arjR00	R:4-123

(no "Pfam Domain" information available for 2ARJ)

Asymmetric Unit(hide GO term definitions)

Chain A,L (KACA_RAT | P01836)

molecular function
	GO:0003823	antigen binding	Interacting selectively and non-covalently with an antigen, any substance which is capable of inducing a specific immune response and of reacting with the products of that response, the specific antibody or specifically sensitized T-lymphocytes, or both. Binding may counteract the biological activity of the antigen.
	GO:0034987	immunoglobulin receptor binding	Interacting selectively and non-covalently with one or more specific sites on an immunoglobulin receptor molecule.
biological process
	GO:0050853	B cell receptor signaling pathway	A series of molecular signals initiated by the cross-linking of an antigen receptor on a B cell.
	GO:0006958	complement activation, classical pathway	Any process involved in the activation of any of the steps of the classical pathway of the complement cascade which allows for the direct killing of microbes, the disposal of immune complexes, and the regulation of other immune processes.
	GO:0042742	defense response to bacterium	Reactions triggered in response to the presence of a bacterium that act to protect the cell or organism.
	GO:0045087	innate immune response	Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
	GO:0006911	phagocytosis, engulfment	The internalization of bacteria, immune complexes and other particulate matter or of an apoptotic cell by phagocytosis, including the membrane and cytoskeletal processes required, which involves one of three mechanisms: zippering of pseudopods around a target via repeated receptor-ligand interactions, sinking of the target directly into plasma membrane of the phagocytosing cell, or induced uptake via an enhanced membrane ruffling of the phagocytosing cell similar to macropinocytosis.
	GO:0006910	phagocytosis, recognition	The initial step in phagocytosis involving adhesion to bacteria, immune complexes and other particulate matter, or an apoptotic cell and based on recognition of factors such as bacterial cell wall components, opsonins like complement and antibody or protein receptors and lipids like phosphatidyl serine, and leading to intracellular signaling in the phagocytosing cell.
	GO:0050871	positive regulation of B cell activation	Any process that activates or increases the frequency, rate or extent of B cell activation.
cellular component
	GO:0072562	blood microparticle	A phospholipid microvesicle that is derived from any of several cell types, such as platelets, blood cells, endothelial cells, or others, and contains membrane receptors as well as other proteins characteristic of the parental cell. Microparticles are heterogeneous in size, and are characterized as microvesicles free of nucleic acids.
	GO:0009897	external side of plasma membrane	The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
	GO:0042571	immunoglobulin complex, circulating	An immunoglobulin complex that is secreted into extracellular space and found in mucosal areas or other tissues or circulating in the blood or lymph. In its canonical form, a circulating immunoglobulin complex is composed of two identical heavy chains and two identical light chains, held together by disulfide bonds. Some forms of are polymers of the basic structure and contain additional components such as J-chain and the secretory component.

Chain Q,R (CD8A_MOUSE | P01731)

molecular function
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0019901	protein kinase binding	Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
biological process
	GO:0042110	T cell activation	The change in morphology and behavior of a mature or immature T cell resulting from exposure to a mitogen, cytokine, chemokine, cellular ligand, or an antigen for which it is specific.
	GO:0002456	T cell mediated immunity	Any process involved in the carrying out of an immune response by a T cell.
	GO:0002250	adaptive immune response	An immune response mediated by cells expressing specific receptors for antigen produced through a somatic diversification process, and allowing for an enhanced secondary response to subsequent exposures to the same antigen (immunological memory).
	GO:0007166	cell surface receptor signaling pathway	A series of molecular signals initiated by activation of a receptor on the surface of a cell. The pathway begins with binding of an extracellular ligand to a cell surface receptor, or for receptors that signal in the absence of a ligand, by ligand-withdrawal or the activity of a constitutively active receptor. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
	GO:0045065	cytotoxic T cell differentiation	The process in which a relatively unspecialized T cell acquires specialized features of a cytotoxic T cell.
	GO:0051607	defense response to virus	Reactions triggered in response to the presence of a virus that act to protect the cell or organism.
	GO:0002376	immune system process	Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
	GO:0050850	positive regulation of calcium-mediated signaling	Any process that activates or increases the frequency, rate or extent of calcium-mediated signaling.
cellular component
	GO:0009986	cell surface	The external part of the cell wall and/or plasma membrane.
	GO:0009897	external side of plasma membrane	The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2arj)

	Sites
(no "Sites" information available for 2arj)

	Cis Peptide Bonds
		Glu H:150 - Pro H:151	[ RasMol ]
		Phe B:148 - Pro B:149	[ RasMol ]
		Phe H:148 - Pro H:149	[ RasMol ]
		Phe Q:10 - Pro Q:11	[ RasMol ]
		Phe R:10 - Pro R:11	[ RasMol ]
		Ser A:7 - Pro A:8	[ RasMol ]
		Ser A:94 - Pro A:95	[ RasMol ]
		Ser L:7 - Pro L:8	[ RasMol ]
		Ser L:94 - Pro L:95	[ RasMol ]
		Tyr A:140 - Pro A:141	[ RasMol ]
		Tyr L:140 - Pro L:141	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2arj
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CD8A_MOUSE \| P01731
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	IGG2B_RAT \| P20761
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	KACA_RAT \| P01836
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CD8A_MOUSE \| P01731
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	IGG2B_RAT \| P20761
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	KACA_RAT \| P01836
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	CD8A_MOUSE \| P01731	:	1bqh 1nez 2atp 3b9k 3dmm
	IGG2B_RAT \| P20761	:	1bfo 1c5d 3b9k
	KACA_RAT \| P01836	:	3b9k

1akj	HUMAN CD8ALPHA-ALPHA IN COMPLEX WITH PMHC
1bqh	MOUSE CD8ALPHA-ALPHA IN COMPLEX WITH PMHC
1cd8	HUMAN CD8ALPHA-ALPHA IGSF DOMIAN DIMER
1nez	MOUSE CD8ALPHA-ALPHA IN COMPLEX WITH TL
1q69	CD8ALPHA CHAIN CYTOPLASMIC DOMAIN AND LCK (FRAGMENT)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (10, 10)

Cis Peptide Bonds (11, 11)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 2)

PROSITE Motifs (1, 2)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (5, 10)

CATH Domains (1, 10)

Pfam Domains (0, 0)

Gene Ontology (26, 39)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File