Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  CAMPATH-1G IGG2B RAT MONOCLONAL FAB
 
Authors :  G. M. T. Cheetham, G. Hale, H. Waldmann, A. C. Bloomer
Date :  20 May 98  (Deposition) - 16 Mar 99  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.60
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C,D  (1x)
Biol. Unit 3:  E,F  (1x)
Biol. Unit 4:  G,H  (1x)
Keywords :  Antibody, Fab, Campath-1G, Cd52 (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  G. M. Cheetham, G. Hale, H. Waldmann, A. C. Bloomer
Crystal Structures Of A Rat Anti-Cd52 (Campath-1) Therapeutic Antibody Fab Fragment And Its Humanized Counterpart.
J. Mol. Biol. V. 284 85 1998
PubMed-ID: 9811544  |  Reference-DOI: 10.1006/JMBI.1998.2157
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CAMPATH-1G ANTIBODY
    Chains: A, C, E, G
    Fragment: FAB FRAGMENT
    Organism Common: BLACK RAT
    Organism Scientific: RATTUS RATTUS
    Organism Taxid: 10117
    Secretion: ASCITIC FLUID
 
Molecule 2 - CAMPATH-1G ANTIBODY
    Chains: B, D, F, H
    Fragment: FAB FRAGMENT
    Organism Common: BLACK RAT
    Organism Scientific: RATTUS RATTUS
    Organism Taxid: 10117
    Secretion: ASCITIC FLUID

 Structural Features

(-) Chains, Units

  12345678
Asymmetric Unit : ABCDEFGH
Biological Unit 1 (1x): AB      
Biological Unit 2 (1x):   CD    
Biological Unit 3 (1x):     EF  
Biological Unit 4 (1x):       GH

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1BFO)

(-) Sites  (0, 0)

(no "Site" information available for 1BFO)

(-) SS Bonds  (16, 16)

Asymmetric Unit
No.Residues
1A:23 -A:88
2A:134 -A:193
3B:22 -B:98
4B:148 -B:201
5C:23 -C:88
6C:134 -C:193
7D:22 -D:98
8D:148 -D:201
9E:23 -E:88
10E:134 -E:193
11F:22 -F:98
12F:148 -F:201
13G:23 -G:88
14G:134 -G:193
15H:22 -H:98
16H:148 -H:201

(-) Cis Peptide Bonds  (24, 24)

Asymmetric Unit
No.Residues
1Ser A:7 -Pro A:8
2Arg A:94 -Pro A:95
3Tyr A:140 -Pro A:141
4Ala B:106 -Pro B:107
5Phe B:154 -Pro B:155
6Glu B:156 -Pro B:157
7Ser C:7 -Pro C:8
8Arg C:94 -Pro C:95
9Tyr C:140 -Pro C:141
10Ala D:106 -Pro D:107
11Phe D:154 -Pro D:155
12Glu D:156 -Pro D:157
13Ser E:7 -Pro E:8
14Arg E:94 -Pro E:95
15Tyr E:140 -Pro E:141
16Ala F:106 -Pro F:107
17Phe F:154 -Pro F:155
18Glu F:156 -Pro F:157
19Ser G:7 -Pro G:8
20Arg G:94 -Pro G:95
21Tyr G:140 -Pro G:141
22Ala H:106 -Pro H:107
23Phe H:154 -Pro H:155
24Glu H:156 -Pro H:157

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1BFO)

(-) PROSITE Motifs  (1, 4)

Asymmetric Unit (1, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1IG_MHCPS00290 Immunoglobulins and major histocompatibility complex proteins signature.KACB_RAT84-90
 
 
 		  4A:191-197
C:191-197
E:191-197
G:191-197
Biological Unit 1 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1IG_MHCPS00290 Immunoglobulins and major histocompatibility complex proteins signature.KACB_RAT84-90
 
 
 		  1A:191-197
-
-
-
Biological Unit 2 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1IG_MHCPS00290 Immunoglobulins and major histocompatibility complex proteins signature.KACB_RAT84-90
 
 
 		  1-
C:191-197
-
-
Biological Unit 3 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1IG_MHCPS00290 Immunoglobulins and major histocompatibility complex proteins signature.KACB_RAT84-90
 
 
 		  1-
-
E:191-197
-
Biological Unit 4 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1IG_MHCPS00290 Immunoglobulins and major histocompatibility complex proteins signature.KACB_RAT84-90
 
 
 		  1-
-
-
G:191-197

(-) Exons   (0, 0)

(no "Exon" information available for 1BFO)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:214
 aligned with KACB_RAT | P01835 from UniProtKB/Swiss-Prot  Length:106

    Alignment length:215
                                                                                                                                                                                                                                          99       
                                                                                                                                        1                                                                                               98 |       
                                     -         -         -         -         -         -         -         -         -         -        |2        12        22        32        42        52        62        72        82        92     | 101     
             KACB_RAT     - ------------------------------------------------------------------------------------------------------------ADAAPTVSIFPPSTEQLATGGASVVCLMNNFYPRDISVKWKIDGTERRDGVLDSVTDQDSKDSTYSMSSTLSLTKADYESHNLYTCEVVHKTSSSPVV-KSFNRNEC 106
               SCOP domains d1bfoa1 A:1-107 Immunoglobulin light chain kappa variable domain, VL-kappa                                 d1bfoa2 A:108-214 Immunoglobulin light chain kap pa constant domain, CL-kappa                                SCOP domains
               CATH domains 1bfoA01 A:1-108 Immunoglobulins                                                                             1bfoA02 A:109-211 Immunoglobulins                                                                       --- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eee..eeee.....eeeeee........eeeeee......eeee.............eeeeee..eeeeee....hhh..eeeeee............eeee.......eeeee...hhhhhh.eeeeeeeee.......eeeeee.....-..eeeee...........eeeeeeeehhhhhh..eeeeeee........eeeeee.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------IG_MHC ----------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1bfo A   1 DIKMTQSPSFLSASVGDRVTLNCKASQNIDKYLNWYQQKLGESPKLLIYNTNNLQTGIPSRFSGSGSGTDFTLTISSLQPEDVATYFCLQHISRPRTFGTGTKLELKRANAAPTVSIFPPSTEQLATGGASVVCLMNKFYPRDISVKWKIDGTER-NGVLNSVTDQDSADSTYSMSSTLSLTKADYQSHNLYTCQVVHKTSSSPVVAKNFNRNEC 214
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150    | |159       169       179       189       199       209     
                                                                                                                                                                                    155 |                                                          
                                                                                                                                                                                      156                                                          


Chain B from PDB  Type:PROTEIN  Length:216
                                                                                                                                                                                                                                                        
               SCOP domains d1bfob1 B:1-121 Immunoglobulin heavy chain variable domain, VH                                                           d1bfob2 B:122-216 Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma                 SCOP domains
               CATH domains 1bfoB01 B:1-121 Immunoglobulins                                                                                          1bfoB02 B:122-216 Immunoglobulins                                                               CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeee..........eeeeeeee...hhh..eeeeee......eeeeee........eee.......eeeee.hhh.eeeeee....hhh.eeeeeee..............eee..........eeeee...........eeeeeeee......eeeeehhh.....eee...eee..eeeeeeeeee........eeeeeehhh.eeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1bfo B   1 EVKLLESGGGLVQPGGSMRLSCAGSGFTFTDFYMNWIRQPAGKAPEWLGFIRDKAKGYTTEYNPSVKGRFTISRDNTQNMLYLQMNTLRAEDTATYYCAREGHTAAPFDYWGQGVMVTVSSAQTTAPSVYPLAPGCGDTTSSTVTLGCLVKGYFPEPVTVTWNSGALSSDVHTFPAVLQSGLYTLTSSVTSSTWPSQTVTCNVAHPASSTKVDKKV 216
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210      


Chain C from PDB  Type:PROTEIN  Length:214
 aligned with KACB_RAT | P01835 from UniProtKB/Swiss-Prot  Length:106

    Alignment length:215
                                                                                                                                                                                                                                          99       
                                                                                                                                        1                                                                                               98 |       
                                     -         -         -         -         -         -         -         -         -         -        |2        12        22        32        42        52        62        72        82        92     | 101     
             KACB_RAT     - ------------------------------------------------------------------------------------------------------------ADAAPTVSIFPPSTEQLATGGASVVCLMNNFYPRDISVKWKIDGTERRDGVLDSVTDQDSKDSTYSMSSTLSLTKADYESHNLYTCEVVHKTSSSPVV-KSFNRNEC 106
               SCOP domains d1bfoc1 C:1-107 Immunoglobulin light chain kappa variable domain, VL-kappa                                 d1bfoc2 C:108-214 Immunoglobulin light chain kap pa constant domain, CL-kappa                                SCOP domains
               CATH domains 1bfoC01 C:1-108 Immunoglobulins                                                                             1bfoC02 C:109-211 Immunoglobulins                                                                       --- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
     Sec.struct. author (1) ....eee..eeeee....eeeeee........eeeeee......eeee.............eeeeee..eeeeee....hhh.eeeeeee...........eeeeee......eeeee...hhhhhh.eeeeeeeee.......-----hhh...-..eeeee...........eeeeeeeehhhhhh..eeeeeee........eeeeee.... Sec.struct. author (1)
     Sec.struct. author (2) ------------------------------------------------------------------------------------------------------------------------------------------------eeeeee----------------------------------------------------------------- Sec.struct. author (2)
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------IG_MHC ----------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1bfo C   1 DIKMTQSPSFLSASVGDRVTLNCKASQNIDKYLNWYQQKLGESPKLLIYNTNNLQTGIPSRFSGSGSGTDFTLTISSLQPEDVATYFCLQHISRPRTFGTGTKLELKRANAAPTVSIFPPSTEQLATGGASVVCLMNKFYPRDISVKWKIDGTER-NGVLNSVTDQDSADSTYSMSSTLSLTKADYQSHNLYTCQVVHKTSSSPVVAKNFNRNEC 214
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150    | |159       169       179       189       199       209     
                                                                                                                                                                                    155 |                                                          
                                                                                                                                                                                      156                                                          


Chain D from PDB  Type:PROTEIN  Length:216
                                                                                                                                                                                                                                                        
               SCOP domains d1bfod1 D:1-121 Immunoglobulin heavy chain variable domain, VH                                                           d1bfod2 D:122-216 Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma                 SCOP domains
               CATH domains 1bfoD01 D:1-121 Immunoglobulins                                                                                          1bfoD02 D:122-216 Immunoglobulins                                                               CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeee..........eeeeeeee...hhh..eeeeee......eeeeee........eee.......eeeee.hhh.eeeeee....hhh.eeeeeee..............eee..........eeeee..........eeeeeeeee......eeeeehhh.....eee...eee..eeeeeeeeeee.......eeeeeehhh.eeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1bfo D   1 EVKLLESGGGLVQPGGSMRLSCAGSGFTFTDFYMNWIRQPAGKAPEWLGFIRDKAKGYTTEYNPSVKGRFTISRDNTQNMLYLQMNTLRAEDTATYYCAREGHTAAPFDYWGQGVMVTVSSAQTTAPSVYPLAPGCGDTTSSTVTLGCLVKGYFPEPVTVTWNSGALSSDVHTFPAVLQSGLYTLTSSVTSSTWPSQTVTCNVAHPASSTKVDKKV 216
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210      


Chain E from PDB  Type:PROTEIN  Length:214
 aligned with KACB_RAT | P01835 from UniProtKB/Swiss-Prot  Length:106

    Alignment length:215
                                                                                                                                                                                                                                          99       
                                                                                                                                        1                                                                                               98 |       
                                     -         -         -         -         -         -         -         -         -         -        |2        12        22        32        42        52        62        72        82        92     | 101     
             KACB_RAT     - ------------------------------------------------------------------------------------------------------------ADAAPTVSIFPPSTEQLATGGASVVCLMNNFYPRDISVKWKIDGTERRDGVLDSVTDQDSKDSTYSMSSTLSLTKADYESHNLYTCEVVHKTSSSPVV-KSFNRNEC 106
               SCOP domains d1bfoe1 E:1-107 Immunoglobulin light chain kappa variable domain, VL-kappa                                 d1bfoe2 E:108-214 Immunoglobulin light chain kap pa constant domain, CL-kappa                                SCOP domains
               CATH domains 1bfoE01 E:1-108 Immunoglobulins                                                                             1bfoE02 E:109-210 Immunoglobulins                                                                      ---- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
     Sec.struct. author (1) ....eee..eeeee....eeeeee........eeeeee......eeee.............eeeeee..eeeeee....hhh.eeeeeee...........eeeeee......eeeee...hhhhhh.eeeeeeeee.......-----hhh...-..eeeee...........eeeeeeeehhhhhh..eeeeeee........eeeeee.... Sec.struct. author (1)
     Sec.struct. author (2) ------------------------------------------------------------------------------------------------------------------------------------------------eeeeee----------------------------------------------------------------- Sec.struct. author (2)
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------IG_MHC ----------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1bfo E   1 DIKMTQSPSFLSASVGDRVTLNCKASQNIDKYLNWYQQKLGESPKLLIYNTNNLQTGIPSRFSGSGSGTDFTLTISSLQPEDVATYFCLQHISRPRTFGTGTKLELKRANAAPTVSIFPPSTEQLATGGASVVCLMNKFYPRDISVKWKIDGTER-NGVLNSVTDQDSADSTYSMSSTLSLTKADYQSHNLYTCQVVHKTSSSPVVAKNFNRNEC 214
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150    | |159       169       179       189       199       209     
                                                                                                                                                                                    155 |                                                          
                                                                                                                                                                                      156                                                          


Chain F from PDB  Type:PROTEIN  Length:216
                                                                                                                                                                                                                                                        
               SCOP domains d1bfof1 F:1-121 Immunoglobulin heavy chain variable domain, VH                                                           d1bfof2 F:122-216 Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma                 SCOP domains
               CATH domains 1bfoF01 F:1-121 Immunoglobulins                                                                                          1bfoF02 F:122-216 Immunoglobulins                                                               CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeee..........eeeeeeee...hhh..eeeeee......eeeeee........eee.......eeeee.hhh.eeeeee....hhh.eeeeeee..............eee..........eeeee..........eeeeeeeee......eeeeehhh.....eee...eee..eeeeeeeeeee.......eeeeeehhh.eeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1bfo F   1 EVKLLESGGGLVQPGGSMRLSCAGSGFTFTDFYMNWIRQPAGKAPEWLGFIRDKAKGYTTEYNPSVKGRFTISRDNTQNMLYLQMNTLRAEDTATYYCAREGHTAAPFDYWGQGVMVTVSSAQTTAPSVYPLAPGCGDTTSSTVTLGCLVKGYFPEPVTVTWNSGALSSDVHTFPAVLQSGLYTLTSSVTSSTWPSQTVTCNVAHPASSTKVDKKV 216
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210      


Chain G from PDB  Type:PROTEIN  Length:214
 aligned with KACB_RAT | P01835 from UniProtKB/Swiss-Prot  Length:106

    Alignment length:215
                                                                                                                                                                                                                                          99       
                                                                                                                                        1                                                                                               98 |       
                                     -         -         -         -         -         -         -         -         -         -        |2        12        22        32        42        52        62        72        82        92     | 101     
             KACB_RAT     - ------------------------------------------------------------------------------------------------------------ADAAPTVSIFPPSTEQLATGGASVVCLMNNFYPRDISVKWKIDGTERRDGVLDSVTDQDSKDSTYSMSSTLSLTKADYESHNLYTCEVVHKTSSSPVV-KSFNRNEC 106
               SCOP domains d1bfog1 G:1-107 Immunoglobulin light chain kappa variable domain, VL-kappa                                 d1bfog2 G:108-214 Immunoglobulin light chain kap pa constant domain, CL-kappa                                SCOP domains
               CATH domains 1bfoG01 G:1-108 Immunoglobulins                                                                             1bfoG02 G:109-211 Immunoglobulins                                                                       --- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
     Sec.struct. author (1) ....eee..eeee.....eeeeee........eeeeee......eeeee............eeeeee..eeeeee....hhh..eeeeee............eeee.......eeeee...hhhhhh.eeeeeeeee.......-----hhh...-..eeeee...........eeeeeeeehhhhhh..eeeeeee........eeeeee.... Sec.struct. author (1)
     Sec.struct. author (2) ------------------------------------------------------------------------------------------------------------------------------------------------eeeeee----------------------------------------------------------------- Sec.struct. author (2)
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------IG_MHC ----------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1bfo G   1 DIKMTQSPSFLSASVGDRVTLNCKASQNIDKYLNWYQQKLGESPKLLIYNTNNLQTGIPSRFSGSGSGTDFTLTISSLQPEDVATYFCLQHISRPRTFGTGTKLELKRANAAPTVSIFPPSTEQLATGGASVVCLMNKFYPRDISVKWKIDGTER-NGVLNSVTDQDSADSTYSMSSTLSLTKADYQSHNLYTCQVVHKTSSSPVVAKNFNRNEC 214
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150    | |159       169       179       189       199       209     
                                                                                                                                                                                    155 |                                                          
                                                                                                                                                                                      156                                                          


Chain H from PDB  Type:PROTEIN  Length:216
                                                                                                                                                                                                                                                        
               SCOP domains d1bfoh1 H:1-121 Immunoglobulin heavy chain variable domain, VH                                                           d1bfoh2 H:122-216 Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma                 SCOP domains
               CATH domains 1bfoH01 H:1-121 Immunoglobulins                                                                                          1bfoH02 H:122-216 Immunoglobulins                                                               CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeee..........eeeeeeee...hhh..eeeeee......eeeeee........eee.......eeeee.hhh.eeeeee....hhh.eeeeeee..............eee..........eeeee...........eeeeeeee.......eeeehhh.....eee...eee..eeeeeeeeee........eeeeeehhh.eeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1bfo H   1 EVKLLESGGGLVQPGGSMRLSCAGSGFTFTDFYMNWIRQPAGKAPEWLGFIRDKAKGYTTEYNPSVKGRFTISRDNTQNMLYLQMNTLRAEDTATYYCAREGHTAAPFDYWGQGVMVTVSSAQTTAPSVYPLAPGCGDTTSSTVTLGCLVKGYFPEPVTVTWNSGALSSDVHTFPAVLQSGLYTLTSSVTSSTWPSQTVTCNVAHPASSTKVDKKV 216
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (4, 16)

Asymmetric Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (1, 16)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)
(-)
Architecture: Sandwich (5577)
(-)
Topology: Immunoglobulin-like (3897)
(-)
Homologous Superfamily: Immunoglobulins (2282)
(-)
Black rat (Rattus rattus) (2)
1a1bfoA02A:109-211
1b1bfoC02C:109-211
1c1bfoF02F:122-216
1d1bfoH02H:122-216
1e1bfoB01B:1-121
1f1bfoD01D:1-121
1g1bfoF01F:1-121
1h1bfoH01H:1-121
1i1bfoG02G:109-211
1j1bfoE02E:109-210
1k1bfoA01A:1-108
1l1bfoC01C:1-108
1m1bfoE01E:1-108
1n1bfoG01G:1-108
1o1bfoB02B:122-216
1p1bfoD02D:122-216

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1BFO)

(-) Gene Ontology  (12, 24)

Asymmetric Unit(hide GO term definitions)
Chain A,C,E,G   (KACB_RAT | P01835)
molecular function
    GO:0003823    antigen binding    Interacting selectively and non-covalently with an antigen, any substance which is capable of inducing a specific immune response and of reacting with the products of that response, the specific antibody or specifically sensitized T-lymphocytes, or both. Binding may counteract the biological activity of the antigen.
    GO:0034987    immunoglobulin receptor binding    Interacting selectively and non-covalently with one or more specific sites on an immunoglobulin receptor molecule.
biological process
    GO:0050853    B cell receptor signaling pathway    A series of molecular signals initiated by the cross-linking of an antigen receptor on a B cell.
    GO:0006958    complement activation, classical pathway    Any process involved in the activation of any of the steps of the classical pathway of the complement cascade which allows for the direct killing of microbes, the disposal of immune complexes, and the regulation of other immune processes.
    GO:0042742    defense response to bacterium    Reactions triggered in response to the presence of a bacterium that act to protect the cell or organism.
    GO:0045087    innate immune response    Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
    GO:0006911    phagocytosis, engulfment    The internalization of bacteria, immune complexes and other particulate matter or of an apoptotic cell by phagocytosis, including the membrane and cytoskeletal processes required, which involves one of three mechanisms: zippering of pseudopods around a target via repeated receptor-ligand interactions, sinking of the target directly into plasma membrane of the phagocytosing cell, or induced uptake via an enhanced membrane ruffling of the phagocytosing cell similar to macropinocytosis.
    GO:0006910    phagocytosis, recognition    The initial step in phagocytosis involving adhesion to bacteria, immune complexes and other particulate matter, or an apoptotic cell and based on recognition of factors such as bacterial cell wall components, opsonins like complement and antibody or protein receptors and lipids like phosphatidyl serine, and leading to intracellular signaling in the phagocytosing cell.
    GO:0050871    positive regulation of B cell activation    Any process that activates or increases the frequency, rate or extent of B cell activation.
cellular component
    GO:0072562    blood microparticle    A phospholipid microvesicle that is derived from any of several cell types, such as platelets, blood cells, endothelial cells, or others, and contains membrane receptors as well as other proteins characteristic of the parental cell. Microparticles are heterogeneous in size, and are characterized as microvesicles free of nucleic acids.
    GO:0009897    external side of plasma membrane    The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
    GO:0042571    immunoglobulin complex, circulating    An immunoglobulin complex that is secreted into extracellular space and found in mucosal areas or other tissues or circulating in the blood or lymph. In its canonical form, a circulating immunoglobulin complex is composed of two identical heavy chains and two identical light chains, held together by disulfide bonds. Some forms of are polymers of the basic structure and contain additional components such as J-chain and the secretory component.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1bfo)
 
  Sites
(no "Sites" information available for 1bfo)
 
  Cis Peptide Bonds
    Ala B:106 - Pro B:107   [ RasMol ]  
    Ala D:106 - Pro D:107   [ RasMol ]  
    Ala F:106 - Pro F:107   [ RasMol ]  
    Ala H:106 - Pro H:107   [ RasMol ]  
    Arg A:94 - Pro A:95   [ RasMol ]  
    Arg C:94 - Pro C:95   [ RasMol ]  
    Arg E:94 - Pro E:95   [ RasMol ]  
    Arg G:94 - Pro G:95   [ RasMol ]  
    Glu B:156 - Pro B:157   [ RasMol ]  
    Glu D:156 - Pro D:157   [ RasMol ]  
    Glu F:156 - Pro F:157   [ RasMol ]  
    Glu H:156 - Pro H:157   [ RasMol ]  
    Phe B:154 - Pro B:155   [ RasMol ]  
    Phe D:154 - Pro D:155   [ RasMol ]  
    Phe F:154 - Pro F:155   [ RasMol ]  
    Phe H:154 - Pro H:155   [ RasMol ]  
    Ser A:7 - Pro A:8   [ RasMol ]  
    Ser C:7 - Pro C:8   [ RasMol ]  
    Ser E:7 - Pro E:8   [ RasMol ]  
    Ser G:7 - Pro G:8   [ RasMol ]  
    Tyr A:140 - Pro A:141   [ RasMol ]  
    Tyr C:140 - Pro C:141   [ RasMol ]  
    Tyr E:140 - Pro E:141   [ RasMol ]  
    Tyr G:140 - Pro G:141   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format | Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1bfo
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  IGG2B_RAT | P20761
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  KACB_RAT | P01835
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  IGG2B_RAT | P20761
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  KACB_RAT | P01835
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        IGG2B_RAT | P20761: 1c5d 2arj 3b9k
        KACB_RAT | P01835: 1c5d 1fn4 1lk3 4uao

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1BFO)