|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 9)
Asymmetric/Biological Unit (1, 9)
|
Sites (9, 9)
Asymmetric Unit (9, 9)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2Z45) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2Z45) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2Z45) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2Z45) |
Exons (0, 0)| (no "Exon" information available for 2Z45) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:109 aligned with Q44177_SYNP2 | Q44177 from UniProtKB/TrEMBL Length:134 Alignment length:109 12 22 32 42 52 62 72 82 92 102 Q44177_SYNP2 3 FKKVAKETAITLQSYLTYQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERLTQ 111 SCOP domains d2z45a_ A: RuBisCo chaperone RbcX SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------- Transcript 2z45 A 3 FKKVAKETAITLQSYLTYQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERLTQ 111 12 22 32 42 52 62 72 82 92 102 Chain B from PDB Type:PROTEIN Length:108 aligned with Q44177_SYNP2 | Q44177 from UniProtKB/TrEMBL Length:134 Alignment length:108 12 22 32 42 52 62 72 82 92 102 Q44177_SYNP2 3 FKKVAKETAITLQSYLTYQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERLT 110 SCOP domains d2z45b_ B: RuBisCo chaperone RbcX SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------ CATH domains Pfam domains (1) RcbX-2z45B01 B:3-110 Pfam domains (1) Pfam domains (2) RcbX-2z45B02 B:3-110 Pfam domains (2) SAPs(SNPs) ------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------ Transcript 2z45 B 3 FKKVAKETAITLQSYLTYQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERLT 110 12 22 32 42 52 62 72 82 92 102
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric/Biological Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2Z45) |
Pfam Domains (1, 2)
Asymmetric/Biological Unit
|
Gene Ontology (1, 1)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (Q44177_SYNP2 | Q44177)
|
||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|