|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 5)| Asymmetric/Biological Unit (3, 5) |
Sites (3, 3)
Asymmetric Unit (3, 3)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2R7Y) |
Cis Peptide Bonds (1, 1)
Asymmetric/Biological Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2R7Y) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2R7Y) |
Exons (0, 0)| (no "Exon" information available for 2R7Y) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:132 aligned with RNH1_BACHD | Q9KEI9 from UniProtKB/Swiss-Prot Length:196 Alignment length:132 71 81 91 101 111 121 131 141 151 161 171 181 191 RNH1_BACHD 62 EIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSDSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADY 193 SCOP domains d2r7ya_ A: BH0863-like Ribonuclease H SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------------ CATH domains Pfam domains -------RNase_H-2r7yA01 A:69-176 ----------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------ Transcript 2r7y A 62 EIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADY 193 71 81 91 101 111 121 131 141 151 161 171 181 191
Chain B from PDB Type:RNA Length:6
2r7y B 1 UCGACA 6
Chain C from PDB Type:DNA Length:6
2r7y C 1 ATgTCg 6
| |
3-SDG
6-SDG
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2R7Y) |
Pfam Domains (1, 1)| Asymmetric/Biological Unit |
Gene Ontology (9, 9)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (RNH1_BACHD | Q9KEI9)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|