|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2PEQ) |
Sites (0, 0)| (no "Site" information available for 2PEQ) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2PEQ) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2PEQ) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2PEQ) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2PEQ) |
Exons (0, 0)| (no "Exon" information available for 2PEQ) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:109 aligned with Q44177_SYNP2 | Q44177 from UniProtKB/TrEMBL Length:134 Alignment length:109 10 20 30 40 50 60 70 80 90 100 Q44177_SYNP2 1 MEFKKVAKETAITLQSYLTYQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERL 109 SCOP domains d2peqa_ A: RuBisCo chaperone RbcX SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------- Transcript 2peq A 1 MEFKKVAKETAITLQSYLTYQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERL 109 10 20 30 40 50 60 70 80 90 100 Chain B from PDB Type:PROTEIN Length:109 aligned with Q44177_SYNP2 | Q44177 from UniProtKB/TrEMBL Length:134 Alignment length:109 10 20 30 40 50 60 70 80 90 100 Q44177_SYNP2 1 MEFKKVAKETAITLQSYLTYQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERL 109 SCOP domains d2peqb_ B: RuBisCo chaperone RbcX SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains (1) RcbX-2peqB01 B:1-109 Pfam domains (1) Pfam domains (2) RcbX-2peqB02 B:1-109 Pfam domains (2) SAPs(SNPs) ------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------- Transcript 2peq B 1 MEFKKVAKETAITLQSYLTYQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERL 109 10 20 30 40 50 60 70 80 90 100
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric/Biological Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2PEQ) |
Pfam Domains (1, 2)
Asymmetric/Biological Unit
|
Gene Ontology (1, 1)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (Q44177_SYNP2 | Q44177)
|
||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|