2P3W - JenaLib

Asymmetric Unit (4, 8)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000307358	1a	ENSE00001134419	chr4:8271492-8272080	589	HTRA3_HUMAN	1-129	129	0	-	-
1.2	ENST00000307358	2	ENSE00001136279	chr4:8284164-8284263	100	HTRA3_HUMAN	129-162	34	0	-	-
1.3	ENST00000307358	3	ENSE00001136273	chr4:8288288-8288510	223	HTRA3_HUMAN	162-236	75	0	-	-
1.4	ENST00000307358	4	ENSE00001136267	chr4:8293097-8293291	195	HTRA3_HUMAN	237-301	65	0	-	-
1.5	ENST00000307358	5	ENSE00001136260	chr4:8294048-8294080	33	HTRA3_HUMAN	302-312	11	0	-	-
1.6	ENST00000307358	6	ENSE00001134412	chr4:8295814-8295928	115	HTRA3_HUMAN	313-351	39	2	A:350-351 B:350-351	2 2
1.8	ENST00000307358	8	ENSE00001136255	chr4:8304190-8304238	49	HTRA3_HUMAN	351-367	17	2	A:351-367 B:351-367	17 17
1.9	ENST00000307358	9	ENSE00001136249	chr4:8305911-8306006	96	HTRA3_HUMAN	367-399	33	2	A:367-399 (gaps) B:367-399 (gaps)	33 33
1.10	ENST00000307358	10	ENSE00001136244	chr4:8307698-8308838	1141	HTRA3_HUMAN	399-453	55	2	A:399-453 B:399-453	55 55

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:110
 aligned with HTRA3_HUMAN | P83110 from UniProtKB/Swiss-Prot  Length:453

    Alignment length:112
                                                                                                                                 453        
                                   359       369       379       389       399       409       419       429       439       449   |     -  
          HTRA3_HUMAN   350 KDWKKRFIGIRMRTITPSLVDELKASNPDFPEVSSGIYVQEVAPNSPSQRGGIQDGDIIVKVNGRPLVDSSELQEAVLTESPLLLEVRRGNDDLLFSIAPEVVM--------   -
               SCOP domains d2p3wa_ A: automated matches                                                                                     SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eee..eeeee.hhhhhhhhhhhh...--....eeeeee...hhhhhhh.....eeeee..ee..hhhhhhhhhhhh..eeeeeee..eeeeeee..eee......... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------PDZ  PDB: A:385-426 UniProt: 385-426      ----------------------------------- PROSITE
           Transcript 1 (1) 1.-----------------------------------------------Exon 1.10  PDB: A:399-453 UniProt: 399-453             -------- Transcript 1 (1)
           Transcript 1 (2) -Exon 1.8         ---------------------------------------------------------------------------------------------- Transcript 1 (2)
           Transcript 1 (3) -----------------Exon 1.9  PDB: A:367-399 (gaps)  -------------------------------------------------------------- Transcript 1 (3)
                 2p3w A 350 GSHMKRFIGIRMRTITPSLVDELKASNPDF--VSSGIYVQEVAPNSPSQRGGIQDGDIIVKVNGRPLVDSSELQEAVLTESPLLLEVRRGNDDLLFSIAPEVVMGGGFGRWV 461
                                   359       369       379  |    389       399       409       419       429       439       449       459  
                                                       379  |                                                                               
                                                          382

Chain B from PDB  Type:PROTEIN  Length:104
 aligned with HTRA3_HUMAN | P83110 from UniProtKB/Swiss-Prot  Length:453

    Alignment length:112
                                                                                                                                 453        
                                   359       369       379       389       399       409       419       429       439       449   |     -  
          HTRA3_HUMAN   350 KDWKKRFIGIRMRTITPSLVDELKASNPDFPEVSSGIYVQEVAPNSPSQRGGIQDGDIIVKVNGRPLVDSSELQEAVLTESPLLLEVRRGNDDLLFSIAPEVVM--------   -
               SCOP domains d2p3wb_ B: automated m        atches                                                                             SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) -----PDZ_2-2p3wB01 B:3        55-447                                                              -------------- Pfam domains (1)
           Pfam domains (2) -----PDZ_2-2p3wB02 B:3        55-447                                                              -------------- Pfam domains (2)
         Sec.struct. author ...eeee..eeeee.hhhhhhh--------......eeeeee...hhhhhhh.....eeeee..ee..hhhhhhhhhhhh..eeeeeee..eeeeeee..eeee........ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------PDZ  PDB: B:385-426 UniProt: 385-426      ----------------------------------- PROSITE
           Transcript 1 (1) 1.-----------------------------------------------Exon 1.10  PDB: B:399-453 UniProt: 399-453             -------- Transcript 1 (1)
           Transcript 1 (2) -Exon 1.8         ---------------------------------------------------------------------------------------------- Transcript 1 (2)
           Transcript 1 (3) -----------------Exon 1.9  PDB: B:367-399 (gaps)  -------------------------------------------------------------- Transcript 1 (3)
                 2p3w B 350 GSHMKRFIGIRMRTITPSLVDE--------PEVSSGIYVQEVAPNSPSQRGGIQDGDIIVKVNGRPLVDSSELQEAVLTESPLLLEVRRGNDDLLFSIAPEVVMGGGFGRWV 461
                                   359       369 |       -|      389       399       409       419       429       439       449       459  
                                               371      380

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (0, 0)

Pfam Domains (1, 2)

Gene Ontology (12, 12)

Asymmetric Unit(hide GO term definitions)

Chain A,B (HTRA3_HUMAN | P83110)

molecular function
	GO:0004175	endopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0005520	insulin-like growth factor binding	Interacting selectively and non-covalently with an insulin-like growth factor, any member of a group of polypeptides that are structurally homologous to insulin and share many of its biological activities, but are immunologically distinct from it.
	GO:0008233	peptidase activity	Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004252	serine-type endopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
	GO:0008236	serine-type peptidase activity	Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
biological process
	GO:0030514	negative regulation of BMP signaling pathway	Any process that stops, prevents, or reduces the frequency, rate or extent of the BMP signaling pathway.
	GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway	Any process that stops, prevents, or reduces the frequency, rate or extent of any TGF-beta receptor signaling pathway.
	GO:0006508	proteolysis	The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
	GO:0001558	regulation of cell growth	Any process that modulates the frequency, rate, extent or direction of cell growth.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2p3w)

	Sites
(no "Sites" information available for 2p3w)

	Cis Peptide Bonds
		Ser A:430 - Pro A:431	[ RasMol ]
		Ser B:430 - Pro B:431	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2p3w
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	HTRA3_HUMAN \| P83110
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.4.21.-
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Exons (4, 8)